Recombinant Escherichia coli Phosphate regulon sensor protein phoR (phoR)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
phoR; nmpB; b0400; JW0390; Phosphate regulon sensor protein PhoR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-431
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
phoR
Target Protein Sequence
MLERLSWKRLVLELLLCCLPAFILGAFFGYLPWFLLASVTGLLIWHFWNLLRLSWWLWVD RSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGAESLPDAVVLTTEEGGI FWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSRPLNLVLNTGRHLEIRVM PYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVLQGYLEMMNEQPLEGAVRE KALHTMREQTQRMEGLVKQLLTLSKIEAAPTHLLNEKVDVPMMLRVVEREAQTLSQKKQT FTFEIDNGLKVSGNEDQLRSAISNLVYNAVNHTPEGTHITVRWQRVPHGAEFSVEDNGPG IAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVNHHESRLNIESTVGKGTRFSFV IPERLIAKNSD
Uniprot No.

Target Background

Function
This protein is a member of the two-component regulatory system PhoR/PhoB, which controls the expression of phosphate regulon genes. PhoR functions as a membrane-associated histidine kinase, phosphorylating PhoB in response to environmental phosphate levels.
Gene References Into Functions
  1. PhoU interacts with PhoR, PstB, and metal ions to form a phosphate-sensing complex in the membrane. PMID: 24563032
  2. Studies indicate a conserved autophosphorylation mechanism, with EnvZ and PhoR orthologs exhibiting trans and cis autophosphorylation, respectively. PMID: 23333741
  3. Protein interaction studies demonstrate binding between EIIA(Ntr) and the histidine kinase PhoR. PMID: 22812494
  4. CreC interacts with PhoB prior to PhoB-PhoR interaction, suggesting a role as a sensor for early phosphate starvation responses. PMID: 18031348
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the PhoR protein and what is its fundamental role in E. coli?

PhoR is a sensor protein that functions as both a negative and positive regulator in the phosphate regulon of Escherichia coli. With excess phosphate, PhoR acts as a negative regulator; conversely, with limited phosphate, it functions as a positive regulator . This dual regulatory capacity allows E. coli to respond appropriately to varying environmental phosphate concentrations. The protein is part of a two-component regulatory system that modulates the expression of genes involved in phosphate metabolism, demonstrating a sophisticated mechanism for bacterial adaptation to nutrient availability.

The function of PhoR is intimately connected to PhoB, which serves as the transcriptional activator for genes in the phosphate regulon. Together, they form a regulatory circuit that responds to environmental phosphate conditions and maintains phosphate homeostasis in the bacterial cell. This regulatory network represents a classic example of how bacteria sense and adapt to changes in their environment.

How is the phoR gene organized within the E. coli genome?

The phoR gene is organized in an operon structure with phoB, with both genes being transcribed from a single promoter located upstream of phoB . This arrangement suggests a coordinated expression pattern for these functionally related proteins. The operon structure was confirmed through experiments involving the construction of recombinant plasmids containing phoR'-'lacZ fusion genes, which demonstrated that removing the phoB promoter upstream of phoR rendered the synthesis of PhoR protein non-inducible regardless of phosphate concentration .

Additionally, when a transcriptional terminator was inserted in the phoB structural gene, the expression of PhoR also became non-inducible, further confirming the operon structure. This genomic organization ensures that the sensor protein (PhoR) and the response regulator (PhoB) are produced in appropriate ratios, facilitating efficient signal transduction in response to phosphate availability.

How does phosphate concentration affect PhoR protein function?

The PhoR protein exhibits a fascinating dual functionality depending on phosphate concentration. Under low phosphate conditions, PhoR functions as a positive regulator, activating the expression of genes in the phosphate regulon . In contrast, when phosphate is abundant, the same protein acts as a negative regulator, suppressing unnecessary expression of these genes .

Interestingly, research has shown that the same low level of PhoR protein in the cell can function in both regulatory capacities depending on the phosphate concentration . This suggests that the functional change in PhoR's regulatory activity is not primarily due to changes in protein quantity but rather to conformational or activity changes in the protein itself in response to phosphate levels. When phosphate becomes limiting, both the quantity of PhoR protein increases and its functional role shifts toward positive regulation, leading to maximal induction of the operon .

What experimental approaches are most effective for studying PhoR function?

For investigating PhoR function, gene fusion techniques have proven particularly valuable. Researchers have successfully constructed recombinant plasmids containing phoR'-'lacZ fusion genes to study the regulation of phoR expression . This approach allows for quantitative assessment of gene expression under various conditions by measuring β-galactosidase activity.

Another effective approach involves creating operon fusions with genes for reporter enzymes such as chloramphenicol acetyltransferase (CAT). This method has been employed to quantitatively compare the expression levels of phoA, phoB, phoE, and pstS genes in various phoB mutants . These fusion constructs provide valuable insights into the regulatory relationships within the phosphate regulon.

For studying protein-protein interactions and signal transduction mechanisms, techniques such as:

  • Site-directed mutagenesis to create specific mutations in conserved domains

  • Protein purification and in vitro reconstitution assays

  • Phosphorylation assays to monitor kinase/phosphatase activities

  • Structural studies (X-ray crystallography or NMR) to determine conformational changes

These experimental approaches should follow systematic experimental design principles, including:

  • Clear definition of independent variables (e.g., phosphate concentration) and dependent variables (e.g., gene expression levels)

  • Formulation of specific, testable hypotheses

  • Implementation of appropriate controls to account for confounding variables

  • Careful consideration of between-subjects or within-subjects experimental designs

How do mutations in the phoR gene affect phosphate regulation?

Mutations in the phoR gene can significantly alter phosphate regulation in E. coli, resulting in various phenotypes depending on the nature and location of the mutation. Analysis of several classical phoR mutants revealed two distinct types of mutations: missense mutations and nonsense mutations .

Missense mutations in phoR often affect highly conserved amino acids that are shared among homologous regulatory proteins such as EnvZ, CpxA, and VirA . These conserved residues likely represent functional domains critical for signal transduction or protein-protein interactions. The altered amino acids in these mutants typically result in modified regulatory functions, potentially affecting either the sensing of phosphate levels or the transmission of the signal to PhoB.

In contrast, five of the six classical phoR mutations studied were nonsense mutations , which would result in truncated proteins. These truncations can lead to complete loss of regulatory function or, in some cases, constitutive activity if regulatory domains are removed while catalytic domains remain intact.

The functional consequences of these mutations can be quantitatively assessed using gene fusion techniques, as demonstrated in studies comparing the expression levels of phoA, phoB, phoE, and pstS genes in various regulatory mutants . Such approaches provide valuable insights into the structure-function relationships within the PhoR protein and its role in phosphate regulation.

What are the molecular mechanisms of PhoR-mediated signal transduction?

PhoR functions as part of a two-component regulatory system where environmental sensing is coupled to transcriptional regulation. At the molecular level, PhoR is a sensor histidine kinase that undergoes autophosphorylation in response to phosphate limitation . This phosphoryl group is subsequently transferred to PhoB, the response regulator, activating it as a transcription factor.

The PhoR protein shares conserved domains with other sensor kinases like EnvZ, CpxA, and VirA, suggesting common mechanisms of signal transduction . These conserved domains likely include:

  • A sensor domain that detects environmental phosphate levels

  • A histidine kinase domain responsible for autophosphorylation

  • A phosphotransferase domain that transfers the phosphoryl group to PhoB

Sequence analysis of phoR mutants has provided valuable insights into these functional domains. Mutant studies have revealed that alteration of highly conserved amino acids often results in modified regulatory functions, highlighting critical residues for signal transduction .

The dual functionality of PhoR (positive regulation in phosphate-limited conditions and negative regulation in phosphate-excess conditions) suggests a sophisticated molecular switch mechanism. Current models propose that PhoR's kinase activity predominates in low-phosphate conditions, promoting PhoB phosphorylation and activation. Conversely, in high-phosphate conditions, PhoR may function primarily as a phosphatase, dephosphorylating and inactivating PhoB, though the precise mechanisms require further investigation.

What is the relationship between PhoR and other components of the phosphate regulon?

PhoR functions within a complex regulatory network that includes multiple components of the phosphate regulon. The primary relationship is between PhoR and PhoB, where PhoR modulates PhoB activity in response to phosphate availability . PhoB, in turn, serves as the transcriptional activator for numerous genes involved in phosphate metabolism.

The phosphate regulon includes several key components:

ComponentFunctionRelationship to PhoR
PhoBTranscriptional activatorReceives phosphorylation signals from PhoR; regulates expression of phoB-phoR operon
PhoAAlkaline phosphataseExpression regulated by activated PhoB; hydrolyzes phosphate esters
PhoEOuter membrane pore proteinInduced by phosphate limitation via PhoB; facilitates phosphate uptake
PstSPhosphate-binding proteinComponent of high-affinity phosphate transport system; expression regulated by PhoB

The PhoR-PhoB system also interacts with the PhoM protein (alternative designation: CreC), which can provide an alternative pathway for PhoB activation under certain conditions, adding another layer of complexity to this regulatory network .

What approaches are used to produce and purify recombinant PhoR protein for in vitro studies?

Production of recombinant PhoR protein for in vitro studies typically employs molecular cloning techniques followed by protein expression and purification. The process generally follows these methodological steps:

  • Gene Cloning: The phoR gene is amplified from E. coli genomic DNA using PCR with specific primers containing appropriate restriction sites. The amplified gene is then inserted into an expression vector, often containing affinity tags (His-tag, GST, etc.) to facilitate purification.

  • Expression System Selection: Common expression systems include:

    • E. coli BL21(DE3) for high-level protein expression

    • Cell-free protein synthesis systems for potentially toxic proteins

    • Baculovirus-insect cell systems for proteins requiring eukaryotic post-translational modifications

  • Protein Expression Optimization: Parameters to optimize include:

    • Induction conditions (temperature, inducer concentration, duration)

    • Growth media composition

    • Co-expression with chaperones if protein folding is problematic

  • Purification Strategy: A multi-step purification approach often includes:

    • Affinity chromatography (Ni-NTA for His-tagged proteins)

    • Ion exchange chromatography

    • Size exclusion chromatography for final polishing

  • Quality Control Assessment:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Mass spectrometry for precise molecular weight determination

    • Circular dichroism to assess secondary structure

    • Activity assays to confirm functional integrity

For PhoR specifically, maintaining the native conformation is crucial for functional studies. As a membrane-associated protein in its native state, recombinant PhoR may require detergent solubilization or truncation strategies focusing on the cytoplasmic domains for successful expression and purification. Additionally, given PhoR's autophosphorylation activity, purification buffers may need to be supplemented with phosphatase inhibitors to preserve the phosphorylation state for certain studies.

How can researchers effectively design experiments to study PhoR regulation?

Designing robust experiments to study PhoR regulation requires careful consideration of variables, controls, and measurement techniques. Following established experimental design principles is crucial :

  • Define Variables Clearly:

    • Independent variable: Typically phosphate concentration in growth media

    • Dependent variables: Gene expression levels, protein activity, growth phenotypes

    • Confounding variables to control: Growth phase, temperature, media composition

  • Formulate Specific Hypotheses:
    For example: "Mutation of histidine residue 348 in PhoR will disrupt autophosphorylation activity, resulting in constitutive repression of the phosphate regulon regardless of environmental phosphate levels."

  • Design Treatments:

    • Vary phosphate concentrations systematically (e.g., 0 μM, 10 μM, 100 μM, 1 mM, 10 mM)

    • Include appropriate controls (wild-type strains, known mutants)

    • Consider time-course experiments to capture regulatory dynamics

  • Select Appropriate Measurement Methods:

    • Reporter gene fusions (lacZ, cat) for transcriptional analysis

    • qRT-PCR for mRNA quantification

    • Western blotting for protein levels

    • Enzymatic assays for functional outcomes (e.g., alkaline phosphatase activity)

  • Statistical Design:

    • Determine appropriate sample sizes through power analysis

    • Plan for statistical analyses appropriate to data type

    • Include biological and technical replicates

When studying PhoR specifically, it's important to consider the dual regulatory nature of the protein and design experiments that can distinguish between its positive and negative regulatory functions. This might involve comparing gene expression profiles under both phosphate-limited and phosphate-excess conditions in wild-type versus mutant strains.

What techniques are available for analyzing PhoR-PhoB interactions?

Understanding PhoR-PhoB interactions is crucial for elucidating phosphate sensing mechanisms. Several complementary techniques provide insights into different aspects of these interactions:

  • Biochemical Approaches:

    • Co-immunoprecipitation to detect physical interactions

    • Far-Western blotting to analyze direct binding

    • Phosphotransfer assays using radiolabeled ATP to track phosphoryl group transfer

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

  • Genetic Approaches:

    • Bacterial two-hybrid systems to detect protein-protein interactions in vivo

    • Suppressor mutation analysis to identify compensatory mutations

    • Site-directed mutagenesis to map interaction domains

  • Structural Approaches:

    • X-ray crystallography of individual domains or co-crystals

    • Nuclear magnetic resonance (NMR) for dynamic interaction studies

    • Cryo-electron microscopy for larger complexes

    • Hydrogen/deuterium exchange mass spectrometry to map interaction surfaces

  • Computational Approaches:

    • Molecular docking simulations

    • Molecular dynamics to model conformational changes

    • Sequence-based prediction of interaction domains

Data from these various approaches should be integrated to develop comprehensive models of PhoR-PhoB interactions. For instance, structural data might reveal potential interaction surfaces, which can then be validated through site-directed mutagenesis and functional assays.

When interpreting experimental results, it's important to consider the potential differences between in vitro and in vivo interactions, as factors such as membrane association, cellular concentrations, and the presence of other regulatory proteins can significantly influence PhoR-PhoB interactions in the cellular context.

What are common challenges in studying PhoR function and how can they be addressed?

Researchers investigating PhoR function frequently encounter several challenges that can complicate experimental design and interpretation:

  • Membrane Association Issues:

    • Challenge: PhoR is a membrane-associated protein, making it difficult to work with in vitro.

    • Solution: Consider working with soluble domains or using detergent solubilization protocols optimized for membrane proteins. Alternatively, fusion proteins with solubility-enhancing tags or truncated constructs focusing on cytoplasmic domains can be utilized.

  • Dual Regulatory Function:

    • Challenge: Distinguishing between PhoR's positive and negative regulatory activities.

    • Solution: Design experiments with precise control of phosphate concentrations and use genetic approaches with specific mutations that lock PhoR in one regulatory state. Time-course experiments can help capture the transition between regulatory states.

  • Cross-talk with Other Two-Component Systems:

    • Challenge: Potential cross-regulation between PhoR-PhoB and other two-component systems.

    • Solution: Use defined in vitro systems with purified components for specificity studies. In vivo, employ strains with deletions in potentially cross-talking systems to isolate PhoR-PhoB specific effects.

  • Phosphorylation State Stability:

    • Challenge: The phosphorylated state of response regulators can be unstable.

    • Solution: Incorporate phosphatase inhibitors in buffers, use phosphomimetic mutations, or develop assays with sufficient temporal resolution to capture transient phosphorylation events.

  • Reproducibility Across Growth Conditions:

    • Challenge: Variations in growth conditions can significantly affect phosphate regulon expression.

    • Solution: Standardize media composition, growth phase harvesting, and environmental parameters. Consider developing chemically defined media specifically optimized for phosphate regulation studies.

Addressing these challenges requires a combination of careful experimental design, appropriate controls, and often the integration of multiple complementary techniques to build a coherent understanding of PhoR function.

How can researchers interpret conflicting data regarding PhoR regulation?

Conflicting results in PhoR regulation studies are not uncommon and can arise from various factors. A systematic approach to resolving such conflicts includes:

  • Examine Experimental Conditions:

    • Compare exact media compositions, as trace phosphate contamination can significantly affect results

    • Verify strain backgrounds, as secondary mutations can influence regulatory outcomes

    • Compare growth phases and cell densities at sampling, as regulatory networks change dynamically

  • Consider Technical Variations:

    • Assess differences in measurement techniques and their sensitivities

    • Evaluate normalization methods used for quantitative data

    • Examine statistical approaches and determine if they are appropriate

  • Analyze Genetic Constructs:

    • Review exact fusion junctions in reporter constructs, as these can affect expression patterns

    • Verify gene copy numbers, as plasmid-based versus chromosomal constructs may differ

    • Check for potential polar effects in mutant strains

  • Reconcile Through Integrative Models:

    • Develop models that can accommodate seemingly contradictory observations

    • Consider kinetic parameters, as temporal dynamics might explain differing snapshots

    • Evaluate thresholds and non-linear responses in regulatory networks

  • Design Decisive Experiments:

    • Identify critical experiments that can definitively distinguish between competing hypotheses

    • Incorporate internal controls that allow direct comparisons within the same experiment

    • Consider collaborative cross-laboratory validation for particularly contentious issues

A comparison table of conflicting results can be particularly valuable:

AspectStudy A FindingsStudy B FindingsPotential Reconciliation
PhoR autophosphorylationHigh activity at pH 7.0Low activity at pH 7.0Different buffer compositions affecting protein conformation
PhoB activationRequires PhoROccurs independently of PhoR in some conditionsAlternative phosphorylation pathways active under specific conditions
Operon structurephoB-phoR co-transcribedIndependent transcription observedCondition-dependent use of alternative promoters

By systematically working through such comparisons, researchers can often identify the specific factors responsible for apparently conflicting results, leading to a more nuanced understanding of the regulatory system.

What emerging technologies might advance our understanding of PhoR function?

Several cutting-edge technologies hold promise for deepening our understanding of PhoR function and the phosphate regulon:

  • CRISPR-Based Technologies:

    • CRISPR interference (CRISPRi) for tunable gene repression to study dosage effects

    • CRISPR activation (CRISPRa) for programmable gene activation

    • Base editing for precise nucleotide modifications without double-strand breaks

    • CRISPR screens to identify new components interacting with the phosphate regulon

  • Single-Cell Technologies:

    • Single-cell RNA-seq to identify cell-to-cell variability in phosphate responses

    • Time-lapse fluorescence microscopy with reporter constructs to track dynamic responses

    • Mass cytometry for multi-parameter analysis of regulatory states

  • Structural Biology Advances:

    • Cryo-electron microscopy for membrane protein complexes

    • Integrative structural biology combining multiple data types

    • AlphaFold and other AI-based structure prediction tools for modeling interaction interfaces

  • Systems Biology Approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Mathematical modeling of the complete phosphate regulatory network

    • Constraint-based metabolic modeling to predict physiological impacts

  • Synthetic Biology Tools:

    • Engineered circuits to probe PhoR function in isolation

    • Biosensors for real-time monitoring of phosphate levels and regulatory responses

    • Optogenetic control of PhoR activity for precise temporal manipulation

These technologies collectively offer unprecedented resolution for studying PhoR function across multiple scales, from atomic-level structural details to system-wide regulatory networks. Integrating data from these various approaches will be essential for developing comprehensive models of phosphate sensing and response mechanisms.

What are unresolved questions about PhoR that merit further investigation?

Despite decades of research, several fundamental questions about PhoR remain unanswered and represent promising avenues for future investigation:

  • Structural Dynamics of Regulation:

    • What conformational changes occur in PhoR during transitions between positive and negative regulatory states?

    • How does phosphate binding (direct or indirect) trigger these conformational changes?

    • What is the three-dimensional structure of full-length PhoR in different regulatory states?

  • Signaling Specificity:

    • How does PhoR maintain signaling specificity with PhoB despite structural similarity to other histidine kinases?

    • Under what conditions might cross-talk occur with other two-component systems?

    • What mechanisms ensure the appropriate balance between kinase and phosphatase activities?

  • Evolutionary Considerations:

    • How conserved is the PhoR-PhoB system across bacterial species?

    • How has the phosphate regulon evolved to accommodate different ecological niches?

    • Can evolutionary patterns reveal critical functional domains not apparent from structural studies alone?

  • Integration with Other Regulatory Networks:

    • How does the phosphate regulon integrate with other stress responses?

    • What role does PhoR play in biofilm formation and virulence in pathogenic strains?

    • How do global regulators influence PhoR-PhoB signaling?

  • Biotechnological Applications:

    • Can engineered PhoR variants serve as biosensors for environmental phosphate monitoring?

    • Could modulation of PhoR activity enhance phosphate accumulation for bioremediation applications?

    • How might understanding PhoR regulation contribute to strategies for controlling bacterial growth in phosphate-limited environments?

Addressing these questions will require interdisciplinary approaches combining genetics, biochemistry, structural biology, systems biology, and computational modeling. The answers will not only advance our fundamental understanding of bacterial signal transduction but may also lead to practical applications in biotechnology, medicine, and environmental science.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.