Recombinant Escherichia coli Phosphate transport system permease protein pstA (pstA)

Shipped with Ice Packs
In Stock

Description

Introduction to PstA in E. coli

The Pst system in E. coli comprises four components: PstS (phosphate-binding protein), PstA and PstC (transmembrane permeases), and PstB (ATPase). PstA is an integral membrane protein encoded by the pstA gene (ECK3719/JW3704) and plays a pivotal role in forming the transmembrane channel for phosphate (Pi_i) transport . The system is induced when extracellular phosphate levels fall below 20 μM, enabling high-affinity Pi_i uptake with a KtK_t of 0.25 μM .

Functional Role in Phosphate Homeostasis

  • Transport mechanism: PstA-PstC channel directs periplasmic Pi_i into the cytoplasm, energized by PstB’s ATP hydrolysis .

  • Regulatory function: The intact Pst system represses the Pho regulon (20+ genes for organic phosphate scavenging) independently of transport activity .

  • Compensation: In cyanobacteria like Nostoc punctiforme, homologs (e.g., PstB1–B4) compensate for pstA knockout via mRNA upregulation under phosphate starvation .

Recombinant Production of PstA

Recombinant PstA is typically expressed in E. coli using systems like the T7 promoter in pET vectors . Key production details include:

ParameterSpecification
Host systemsE. coli BL21(DE3), Origami™, or SHuffle® T7 Express
VectorpET series with T7/ lac hybrid promoters for tight regulation
TaggingN-terminal His tag for purification (e.g., MBS7062231)
Purity≥85% (SDS-PAGE)
ApplicationsStructural studies, transport mechanism analysis, ligand interaction assays

For instance, MyBioSource offers recombinant PstA (residues 1–295) with a His tag, expressed in E. coli .

Key Research Findings

  • Mutation studies: Site-directed mutagenesis revealed that Arg-220 in PstA is essential for transport, while Arg-170 and Glu-173 substitutions had no effect .

  • Ligand interactions: Structural homologs in Listeria monocytogenes bind cyclic-di-AMP (Kd=1.4 μMK_d = 1.4\ \mu M), suggesting regulatory cross-talk in Firmicutes .

  • Compensatory mechanisms: In N. punctiforme, pstB2B4 mRNA levels rise to offset pstB1 deletion, maintaining phosphate uptake .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
pstA; phoT; b3726; JW3704; Phosphate transport system permease protein PstA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
pstA
Target Protein Sequence
MAMVEMQTTAALAESRRKMQARRRLKNRIALTLSMATMAFGLFWLIWILMSTITRGIDGM SLALFTEMTPPPNTEGGGLANALAGSGLLILWATVFGTPLGIMAGIYLAEYGRKSWLAEV IRFINDILLSAPSIVVGLFVYTIVVAQMEHFSGWAGVIALALLQVPIVIRTTENMLKLVP YSLREAAYALGTPKWKMISAITLKASVSGIMTGILLAIARIAGETAPLLFTALSNQFWST DMMQPIANLPVTIFKFAMSPFAEWQQLAWAGVLIITLCVLLLNILARVVFAKNKHG
Uniprot No.

Target Background

Function
This protein is part of the binding-protein-dependent transport system for phosphate. It is likely responsible for translocating the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of the PstA protein in E. coli's phosphate transport system?

PstA is an integral membrane protein of the phosphate-specific transport system of Escherichia coli that contains six transmembrane helices. It forms part of the transmembrane channel that transports inorganic phosphate (Pi) through the cytoplasmic membrane. The protein is anchored into the inner cell membrane and works in conjunction with PstC to create the channel necessary for phosphate transport . The structural integrity of PstA is critical for proper insertion into the membrane and subsequent functionality of the entire Pst system.

How does PstA function within the complete Pst transport system?

PstA functions as one of the critical components in the phosphate-specific transport (Pst) system, which is a high-affinity ATP-binding cassette (ABC) transporter. In this system, PstA and PstC together form a transmembrane channel that transports phosphate through the cytoplasmic membrane. The cytoplasmic sides of PstA and PstC are linked to the PstB component, which is involved in ATP hydrolysis needed for energizing the transmembrane channel, thus enabling it to function as a phosphate transporter . The Pst system becomes activated when external phosphate concentrations fall below 20 μM, demonstrating its role in phosphate acquisition under limiting conditions .

What is the relationship between PstA and alkaline phosphatase regulation in E. coli?

The Pst system in E. coli not only functions in phosphate transport but also plays a role in regulating phosphate metabolism. Research has shown that while mutations in the pstA gene can reduce phosphate transport capacity, some mutations may not affect the regulation of phoA (which encodes alkaline phosphatase) . Specifically, disruption of pstA can reduce phosphate transport by affecting the protein's affinity for insertion into the membrane. When the Pst system detects low phosphate conditions, alkaline phosphatase is activated to hydrolyze organic phosphate esters in the periplasm, increasing bioavailable phosphate sources .

How do specific amino acid mutations in PstA affect phosphate transport function?

Site-directed mutagenesis studies have revealed that certain amino acid residues in PstA are critical for phosphate transport. Notably, the Arg-220→Gln mutation results in complete loss of phosphate transport through the Pst system, while the alkaline phosphatase activity remains repressed . Interestingly, neither the Arg-170→Gln nor the Glu-173→Gln mutations affected phosphate transport, indicating that not all amino acids within the transmembrane domains are functionally equivalent . These amino acid residues were selected for mutation studies based on protein structure predictions that placed them within the membrane, highlighting the importance of targeted mutation approaches in understanding structure-function relationships in transport proteins.

What experimental approaches are optimal for studying PstA membrane insertion and topology?

Studying membrane protein topology requires specialized techniques due to the hydrophobic nature of transmembrane domains. For PstA, researchers typically employ:

  • Fusion protein techniques: Creating fusions with reporter proteins (such as PhoA, GFP, or LacZ) at various positions to determine membrane orientation

  • Cysteine scanning mutagenesis: Introducing cysteine residues at specific positions followed by accessibility studies with membrane-impermeable reagents

  • Protease protection assays: Determining which regions are accessible to proteases in intact membrane vesicles versus detergent-solubilized proteins

These approaches, combined with computational prediction tools, provide comprehensive insights into the membrane topology of PstA and its six transmembrane helical segments that are critical for phosphate transport channel formation.

How does the redundancy in phosphate transport systems affect experimental design when studying PstA function?

When studying PstA function, researchers must account for the redundancy in phosphate transport systems that exists in many bacteria. In E. coli, both the Pst and Pit systems can transport phosphate . The Pit system operates constitutively and has a higher affinity for phosphate, while the Pst system is induced under low phosphate conditions .

This redundancy creates challenges when designing experiments to study PstA specifically, as phenotypic effects of pstA mutations might be masked by compensatory transport through alternative systems. Researchers must consider:

  • Using phosphate-limited growth conditions to induce and study the Pst system specifically

  • Creating double or triple mutants that eliminate alternative phosphate transport pathways

  • Using radioactive phosphate (³²P) uptake assays under carefully controlled conditions that can differentiate between transport systems

These considerations ensure that experimental results accurately reflect PstA function rather than compensatory effects from other transport systems.

What are the most effective expression systems for producing recombinant PstA for structural studies?

Producing sufficient quantities of properly folded membrane proteins like PstA presents significant challenges. Based on recent advances in expression systems, the following approaches have proven most effective:

Expression SystemAdvantagesLimitationsYield (mg/L culture)
pET28a with BL21(DE3)High expression levels, well-establishedPotential toxicity, inclusion body formation1-5
pET systems with improved genetic modulesIncreased protein production, reduced toxicityRequires optimization2-10
C41/C43(DE3) strainsSpecialized for membrane proteinsLower yields than optimized systems0.5-3
LEMO21(DE3) systemTunable expression, reduces toxicityComplex optimization required1-7

The pET series of expression plasmids are widely used for recombinant protein production in E. coli . Recent improvements in pET vector design have addressed some limitations in the genetic modules controlling transcription and translation, resulting in increased protein production . When expressing PstA, researchers should consider using these improved pET designs along with specialized E. coli strains engineered for membrane protein expression.

What purification strategies maintain the native conformation of PstA for functional studies?

Purifying membrane proteins while maintaining their native conformation requires specialized approaches:

  • Membrane isolation: Isolate membranes by differential centrifugation following cell disruption

  • Detergent selection: Screen multiple detergents (DDM, LMNG, DMNG) for effective solubilization while preserving function

  • Affinity chromatography: Use His-tagged constructs with Ni-NTA resins in the presence of appropriate detergents

  • Size exclusion chromatography: Remove aggregates and ensure homogeneity

  • Reconstitution into liposomes or nanodiscs: For functional assays, reconstitute purified PstA (with other Pst components) into artificial membrane systems

For PstA specifically, maintaining its association with PstC during purification may be crucial for stability and subsequent functional studies, as these proteins form the transmembrane channel component of the Pst system .

How can CRISPR-Cas9 and λ-Red recombination be utilized for chromosomal integration of modified pstA genes?

Recent advances in genomic integration techniques provide powerful approaches for studying PstA in its native context:

The λ-Red assisted homology-dependent recombination system, combined with CRISPR-Cas9, offers an efficient method for integrating large synthetic constructs into the E. coli chromosome . For pstA modifications, this approach provides several advantages:

  • It allows integration of modified pstA genes at their native locus, ensuring proper regulation

  • The efficiency can reach 100% for integrations, even for large constructs up to 12 kb

  • It avoids issues associated with plasmid-based expression, such as copy number effects and plasmid loss

Implementation involves:

  • Designing homology arms matching the target genomic region

  • Incorporating the modified pstA sequence between these homology arms

  • Using λ-Red proteins (Gam, Bet, Exo) to facilitate recombination

  • Employing CRISPR-Cas9 to introduce a double-strand break in the wild-type sequence, enhancing selection for recombinants

This approach is particularly valuable for studying phosphate transport in conditions that closely mimic the natural physiological state of E. coli.

How can researchers quantitatively assess phosphate transport activity in PstA mutants?

Quantifying phosphate transport activity in PstA mutants requires multiple complementary approaches:

  • Radioactive phosphate uptake assays: Measure the rate of ³²P uptake in cells expressing wild-type versus mutant PstA proteins under phosphate-limiting conditions

  • Growth rate analysis: Compare growth rates in phosphate-limited media, which can serve as a proxy for transport efficiency

  • Membrane vesicle transport assays: Prepare inside-out membrane vesicles to measure ATP-dependent phosphate uptake in a controlled system

These quantitative measurements should be analyzed using appropriate kinetic models to determine parameters such as Km and Vmax, allowing for precise characterization of how specific mutations affect transport efficiency. For the Arg-220→Gln mutation in PstA, for example, researchers observed complete loss of phosphate transport activity while alkaline phosphatase regulation remained intact , demonstrating the value of multiple assessment methods.

What approaches help distinguish between effects on phosphate transport versus regulatory functions when studying PstA mutations?

The Pst system plays dual roles in phosphate transport and regulation of the Pho regulon. To distinguish between these functions when studying PstA mutations:

  • Measure alkaline phosphatase activity: Alkaline phosphatase is regulated by the Pho regulon; its activity serves as a readout of regulatory function

  • Assess phosphate uptake directly: Using ³²P to measure transport independent of regulatory effects

  • Analyze gene expression profiles: Examine transcription of Pho regulon genes using qPCR or RNA-seq

  • Complementation studies: Express wild-type PstA from a plasmid in mutant strains to determine if transport, regulation, or both functions are restored

This approach has revealed that some mutations, like Arg-220→Gln in PstA, can disrupt phosphate transport while leaving regulatory functions intact , providing insights into the structural elements that separate these two functions.

How should researchers address potential compensatory mechanisms when interpreting pstA mutation phenotypes?

When interpreting phenotypes resulting from pstA mutations, researchers must consider several compensatory mechanisms that may mask or alter observed effects:

  • Parallel transport systems: The Pit phosphate transport system may compensate for Pst system deficiencies

  • Upregulation of alternative genes: Similar to observations in Nostoc punctiforme, where deletion of pstB1 led to compensatory upregulation of pstB2, pstB3, and pstB4

  • Post-translational modifications: These may alter the activity of remaining transport components

  • Metabolic rewiring: Changes in central metabolism may occur to accommodate phosphate limitation

To address these issues, researchers should:

  • Use genetic backgrounds where compensatory systems are also disabled

  • Employ time-course studies to capture transient responses before compensation occurs

  • Use systems biology approaches, including proteomics and metabolomics, to identify compensatory mechanisms

  • Design control experiments that can distinguish direct effects of pstA mutations from secondary adaptations

Understanding these compensatory mechanisms is crucial for accurate interpretation of mutation phenotypes and for developing a comprehensive model of phosphate homeostasis in E. coli.

How can cryo-electron microscopy advance our understanding of PstA structure and function?

Cryo-electron microscopy (cryo-EM) represents a transformative approach for elucidating the structure of membrane proteins like PstA without the need for crystallization. For studying PstA:

  • High-resolution structural determination: Cryo-EM can resolve structures at near-atomic resolution, revealing precise positioning of the six transmembrane helices of PstA and its interaction with PstC

  • Conformational dynamics: By capturing multiple conformational states, cryo-EM can help elucidate the structural changes that occur during phosphate transport

  • Complex assembly visualization: The technique allows visualization of how PstA integrates with other Pst system components (PstS, PstC, PstB) to form a functional transport complex

These structural insights would complement the existing mutational data, such as the critical role of Arg-220 in phosphate transport , by providing a structural context for understanding how specific residues contribute to channel formation and function.

What synthetic biology approaches can optimize recombinant PstA expression and function?

Synthetic biology offers innovative approaches to optimize recombinant PstA expression and function:

  • Codon optimization: Adjusting codon usage to match E. coli preferences while avoiding rare codons that limit translation efficiency

  • Synthetic promoter design: Creating promoters with precise control over expression levels to prevent toxicity from membrane protein overexpression

  • Fusion partner screening: Systematically testing fusion partners that enhance membrane insertion and proper folding

  • Directed evolution: Developing high-throughput screening methods to evolve PstA variants with improved stability or function

Implementation of improved genetic modules in expression vectors, as demonstrated for pET plasmids , can significantly increase protein production. For membrane proteins like PstA, these optimizations must balance expression levels with the cell's capacity for proper membrane protein insertion to avoid toxicity and inclusion body formation.

How does the phosphate transport mechanism of PstA compare across different bacterial species?

Comparative analysis of PstA across bacterial species reveals important evolutionary and functional insights:

SpeciesPstA Homology to E. coliKey Structural DifferencesFunctional Specializations
E. coli100%Reference structureHigh-affinity phosphate transport under limiting conditions
Synechocystis sp.60-70%Different loop regionsDifferential expression of two Pst systems (Pst1 and Pst2)
Nostoc punctiforme55-65%Extended periplasmic domainsMultiple redundant Pst systems across three distinct operons
Mycobacterium tuberculosis45-55%Additional transmembrane segmentAdaptation to intracellular lifestyle
Bacillus subtilis40-50%Different charged residues in channelAltered phosphate affinity

This comparative approach helps identify conserved residues that are likely essential for core transport functions versus variable regions that may reflect adaptation to different ecological niches or regulatory requirements. For instance, cyanobacteria like Nostoc punctiforme have evolved multiple redundant phosphate uptake systems distributed across three distinct operons, providing enhanced resilience to phosphate limitation .

By integrating data from diverse bacterial species, researchers can develop more comprehensive models of phosphate transport mechanisms and identify potential targets for species-specific interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.