Recombinant Escherichia coli Phosphate transport system permease protein pstC (pstC)

Shipped with Ice Packs
In Stock

Description

Overview of PstC

PstC is an integral membrane protein component of the high-affinity phosphate (Pi) transport system (Pst) in E. coli. It functions alongside PstA (another membrane protein), PstB (ATPase), and PstS (periplasmic Pi-binding protein) to form an ATP-binding cassette (ABC) transporter. This system is critical for Pi uptake under low-phosphate conditions and regulates the PHO regulon via signal transduction .

Key Features of PstC

PropertyDescription
GenepstC (synonyms: ECK3720, JW3705, phoW)
Molecular Weight~35–50 kDa (varies by organism)
Structure6 transmembrane helices; forms channel with PstA
FunctionFacilitates Pi translocation across membrane; interacts with PstA and PstB
RegulationControlled by the PHO regulon; expressed under Pi-limitation

Structure and Functional Insights

PstC’s structure includes critical residues and proline motifs essential for transport activity. Mutational studies have identified:

Critical Residues in PstC

ResidueFunctionEffect of Mutation
Arg-237Interacts with PstA’s Arg-220; stabilizes transport conformationR237Q substitution abolishes Pi transport .
Glu-240Forms salt bridge with PstA’s Arg-220; critical for channel closureE240Q mutation disrupts Pi uptake .
ProlineIn transmembrane helices 3/4; maintains helical structureSingle Pro→Leu substitutions inactivate transport; Pro→Ala retains partial function .

Role in Transport Mechanism

  • PstC and PstA form a transmembrane channel that couples ATP hydrolysis (via PstB) to Pi translocation .

  • Double Pro→Ala mutations in PstC create a permanently open channel, while analogous mutations in PstA lock the system closed .

Mutational Analysis

Studies using site-directed mutagenesis revealed:

  • Arg-237 and Glu-240: These residues are indispensable for Pi transport but not for PHO regulon repression. Mutants (e.g., R237Q, E240Q) show no Pi uptake but retain alkaline phosphatase repression .

  • PstB Interactions: The nucleotide-binding site in PstB (Gly-48, Lys-49) is critical. Mutations (G48I, K49Q) disrupt ATPase activity, halting transport and derepressing the PHO regulon .

Suppression Mutations

In Nostoc punctiforme, a suppressor mutation in pstC restored Pi uptake by creating an alternative reading frame, producing a functional 494-amino-acid PstC variant .

Recombinant Production of PstC

Recombinant PstC is produced for structural and functional studies. Key production parameters include:

Host SystemPurityApplications
E. coli≥85%Biochemical assays, crystallization
Yeast/Baculovirus≥85%Mammalian cell expression for post-translational modifications
Cell-free systems≥85%Rapid production for high-throughput screening

Data sourced from commercial recombinant protein catalogs .

Interaction with PstA

  • Residue Pairing: Arg-220 (PstA) and Arg-237/Glu-240 (PstC) form a functional triad. Mutations in these residues disrupt Pi binding and transport .

  • Conformational Changes: PstC’s proline residues modulate helix flexibility, enabling channel opening/closing during transport .

Applications in Biotechnology

  • Mechanistic Studies: Recombinant PstC aids in elucidating ABC transporter dynamics and ATP-coupled transport .

  • Crop Engineering: Insights into PstC function guide efforts to enhance Pi uptake in plants under nutrient-limiting conditions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pstC; phoW; b3727; JW3705; Phosphate transport system permease protein PstC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
pstC
Target Protein Sequence
MAATKPAFNPPGKKGDIIFSVLVKLAALIVLLMLGGIIVSLIISSWPSIQKFGLAFLWTK EWDAPNDIYGALVPIYGTLVTSFIALLIAVPVSFGIALFLTELAPGWLKRPLGIAIELLA AIPSIVYGMWGLFIFAPLFAVYFQEPVGNIMSNIPIVGALFSGPAFGIGILAAGVILAIM IIPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPFTKNGVIGGIMLGLGRALG ETMAVTFIIGNTYQLDSASLYMPGNSITSALANEFAEAESGLHVAALMELGLILFVITFI VLAASKFMIMRLAKNEGAR
Uniprot No.

Target Background

Function
This protein is a component of the binding-protein-dependent transport system for phosphate. It is likely responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is PstC and what is its function in E. coli?

PstC is a hydrophobic subunit of the Pst (Phosphate-specific transport) system in Escherichia coli. It functions as a critical component of this high-affinity phosphate transport system, which is a member of the ABC transporter family. The Pst system is composed of four proteins that form a complex responsible for phosphate uptake when external phosphate concentrations are low. This system is induced when external phosphate concentrations fall below the millimolar range and has a high affinity for phosphate with an apparent Km of approximately 0.2 μM .

The complete Pst system consists of the proteins encoded by the pstSCAB operon, where PstC serves as one of the two hydrophobic subunits (alongside PstA) that form the membrane channel through which phosphate is transported .

How does PstC relate to other phosphate transport systems in E. coli?

E. coli contains at least two major systems for transporting inorganic phosphate (Pi). The Pst system (including PstC) is a high-affinity transport system that is induced under phosphate-limiting conditions. In contrast, the low-affinity inorganic phosphate transporter (Pit) system, which includes PitA and PitB, is constitutively expressed and operates when phosphate is plentiful .

The Pit system is dependent on the proton motive force for energy and has a reported apparent Km of 25-38 μM in whole cells and 11.9 μM in membrane vesicles. This is significantly higher (indicating lower affinity) than the Pst system's Km of approximately 0.2 μM .

These systems allow E. coli to adapt to varying phosphate concentrations in the environment, with the Pst system (including PstC) being particularly important during phosphate starvation conditions.

What techniques can be used to express recombinant PstC in E. coli?

Recombinant PstC can be expressed in E. coli using various molecular biology techniques. The most common approach involves cloning the pstC gene into an appropriate expression vector. When selecting an expression system, researchers should consider the following methodological aspects:

  • Plasmid selection: Choose an expression plasmid with appropriate features including replicon type, promoter strength, selection markers, and fusion protein options .

  • Expression strain: Select an E. coli strain optimized for membrane protein expression, as PstC is a membrane-embedded protein.

  • Induction conditions: Optimize temperature, inducer concentration, and expression duration to maximize properly folded protein yield.

  • Protein extraction and purification: Develop protocols for membrane protein extraction using detergents and appropriate chromatography techniques.

For membrane proteins like PstC, it's important to consider the challenges of proper folding and insertion into the membrane. Expression at lower temperatures (16-30°C) and using weaker promoters can often improve the yield of functional protein .

What role do specific residues in PstC play in phosphate transport?

Mutational analysis of PstC has provided insights into the functional importance of specific amino acid residues. Research has shown that while no single charged residue among 19 studied was absolutely essential for phosphate uptake, certain residues were found to significantly impact transport efficiency .

Specifically, residues R237 and E241 in the PstC protein have been identified as important for phosphate transport. While altering these residues does not completely abolish function, mutations at these positions result in measurable reductions in transport activity .

This research suggests that phosphate transport by the Pst system likely involves multiple residues working in concert, with some redundancy in the system. The charged residues may contribute to creating the appropriate electrostatic environment for phosphate binding and translocation across the membrane.

How does PstC interact with other components of the Pst system?

PstC functions as part of a complex with other Pst proteins (PstS, PstA, and PstB). Understanding these protein-protein interactions is crucial for elucidating the mechanism of phosphate transport.

The current model suggests:

  • PstS is a periplasmic binding protein that captures phosphate with high affinity

  • PstC and PstA form the transmembrane channel through which phosphate passes

  • PstB provides the energy for transport through ATP hydrolysis

Research techniques to study these interactions include:

  • Cross-linking studies to identify interacting domains

  • Co-immunoprecipitation to verify protein-protein interactions

  • Structural studies using X-ray crystallography or cryo-electron microscopy

  • FRET (Förster Resonance Energy Transfer) to study dynamic interactions in living cells

Data from these approaches have shown that specific domains in PstC interact with corresponding regions in PstA to form the functional channel, while other regions interact with PstB to couple ATP hydrolysis to conformational changes required for transport .

How is pstC expression regulated in response to phosphate limitation?

The pstC gene is part of the pst operon, which is regulated by the Pho regulon in response to phosphate availability. When phosphate is limited, the Pho regulon is activated, leading to increased expression of the pst genes .

The regulatory mechanism involves:

  • A two-component system consisting of PhoR (sensor kinase) and PhoB (response regulator)

  • Under phosphate-limiting conditions, PhoR phosphorylates PhoB

  • Phosphorylated PhoB binds to specific sequences (Pho boxes) in the promoter regions of Pho regulon genes

  • This binding activates transcription of the pst operon, including pstC

Researchers studying pstC regulation typically monitor gene expression using:

  • RT-qPCR to measure mRNA levels

  • Reporter gene assays (e.g., lacZ fusions) to monitor promoter activity

  • Western blotting to assess protein levels

  • Chromatin immunoprecipitation to study PhoB binding

Understanding this regulation is important for designing experiments with recombinant PstC, as expression conditions should account for potential interference with the native regulatory mechanisms .

How should experiments be designed to study PstC function?

When designing experiments to study PstC function, researchers should consider both genetic and biochemical approaches. A comprehensive experimental design typically includes:

  • Genetic manipulation of pstC:

    • Creation of pstC deletion mutants

    • Site-directed mutagenesis of specific residues

    • Complementation studies with wild-type and mutant alleles

  • Functional assays:

    • Radioactive phosphate (32P) uptake assays

    • Growth assays under phosphate-limiting conditions

    • Membrane vesicle transport assays

  • Control considerations:

    • Include wild-type strains as positive controls

    • Use strains with complete pst operon deletions as negative controls

    • Consider pitA/pitB status when interpreting results

  • Data collection timepoints:

    • Initial rates (30 seconds to 2 minutes)

    • Steady-state accumulation (5-30 minutes)

    • Long-term adaptation (hours to days)

A typical experimental design would include multiple biological replicates (minimum of three) and appropriate technical replicates to ensure statistical validity. Environmental conditions should be carefully controlled, particularly phosphate concentrations, pH, and temperature, as these factors significantly impact transporter function .

What are the best methods for measuring PstC-mediated phosphate transport?

Several methodologies can be employed to measure phosphate transport mediated by PstC. Each has advantages and limitations that should be considered based on research objectives:

MethodPrincipleAdvantagesLimitationsTypical Data Output
Radioactive 32P uptakeDirect measurement of labeled phosphate accumulationHigh sensitivity, direct measurementRequires radioactive materials, specialized facilitiesTime course of accumulation (pmol/mg protein vs. time)
Growth assays in low-Pi mediaMonitors cell growth as a proxy for transportSimple, high throughputIndirect measure, influenced by multiple factorsGrowth curves (OD600 vs. time)
Membrane vesicle assaysMeasures transport in isolated membrane vesiclesEliminates cellular metabolism effectsTechnical complexity, artifactual effectsInitial transport rates (nmol/min/mg protein)
Fluorescent phosphate analogsUses fluorescent phosphate analogs and microscopyReal-time visualization, single-cell resolutionLimited specificity, potential analog effectsFluorescence intensity vs. time or position

When reporting transport data, researchers should present both initial rates and steady-state levels, as these provide different information about transporter function. Initial rates primarily reflect the activity of the transporter, while steady-state levels incorporate effects of metabolism and potential efflux .

How can one distinguish between PstC-mediated transport and other phosphate transport systems?

Distinguishing between phosphate transport mediated by PstC and other systems (particularly PitA and PitB) is crucial for accurate interpretation of experimental results. Several approaches can be employed:

  • Genetic approaches:

    • Use strains with deletions of pitA and pitB genes

    • Create specific pstC mutations while maintaining other pst genes

    • Use complementation with plasmid-encoded pstC variants

  • Biochemical approaches:

    • Exploit the different kinetic properties (Km values) of the transporters

    • Use arsenate as a competitive inhibitor (affects Pit systems differently than Pst)

    • Manipulate proton motive force (affects Pit but not Pst systems)

  • Experimental design considerations:

    • Vary external phosphate concentrations (Pst dominates at low Pi, Pit at high Pi)

    • Perform assays at different pH values (differentially affects transporters)

    • Compare transport rates in the presence/absence of ATP or metabolic inhibitors

A methodological example from the literature demonstrates how a pitA pitB ΔpstC345 triple mutant was unable to grow on medium containing 500 μM Pi, while a strain carrying a pitB+ cosmid clone could grow under these conditions, indicating functional complementation .

How should data from PstC transport experiments be analyzed and presented?

Data analysis and presentation for PstC transport experiments should follow rigorous scientific standards and include appropriate statistical treatments. Key considerations include:

  • Data organization:

    • Organize data in clear tables with independent variables (e.g., strain type, mutation) and dependent variables (e.g., transport rate, growth)

    • Include appropriate units (e.g., nmol Pi/min/mg protein)

    • Present means, standard deviations, and sample sizes for all measurements

  • Statistical analysis:

    • Apply appropriate statistical tests (t-tests, ANOVA) to determine significance

    • Include p-values and confidence intervals

    • Consider using non-parametric tests if data do not meet normality assumptions

  • Graphical representation:

    • Use line graphs for time-course data

    • Use bar graphs or scatter plots for comparing different strains/conditions

    • Include error bars representing standard deviation or standard error

  • Table format example:

StrainPstC VariantInitial Transport Rate (nmol Pi/min/mg)Steady-State Accumulation (nmol Pi/mg)Growth Rate in Low-Pi Medium (doublings/h)
Wild-typeNative45.2 ± 3.8158.7 ± 12.30.48 ± 0.05
ΔpstCNone2.1 ± 0.424.5 ± 3.20.12 ± 0.03
ΔpstCPstC-WT (plasmid)40.8 ± 4.2149.3 ± 14.80.45 ± 0.04
ΔpstCPstC-R237A18.3 ± 2.185.2 ± 8.90.29 ± 0.03

When creating data tables for experimental results, ensure they are visually appealing and well-formatted, with clear headers identifying independent and dependent variables and appropriate units. Resize columns as needed to accommodate the data, and use merge and center functions for titles spanning multiple columns6.

How can conflicting data about PstC function be resolved?

Researchers sometimes encounter conflicting data when studying PstC function, which can arise from various sources including methodological differences, strain variations, or environmental factors. To resolve such conflicts:

  • Methodological approach:

    • Repeat experiments using standardized protocols across all conditions

    • Vary one parameter at a time to identify sources of variation

    • Use multiple complementary techniques to verify observations

    • Collaborate with labs reporting different results to exchange materials and protocols

  • Consider strain differences:

    • E. coli strains can have significant genomic differences

    • Background mutations may affect transporter function

    • Fully sequence the relevant genomic regions in experimental strains

    • Test hypotheses in multiple strain backgrounds

  • Environmental variables:

    • Standardize growth media, especially phosphate concentrations

    • Control temperature, pH, and aeration conditions

    • Consider media contaminants (especially phosphate in supposedly Pi-free media)

    • Document and report all environmental conditions in publications

A systematic approach to resolving conflicts involves creating a comprehensive table comparing experimental conditions, strain genotypes, and results across studies. This can help identify patterns and potential sources of discrepancies .

What ethical considerations apply to research on recombinant PstC?

While bacterial research generally involves fewer ethical concerns than work with higher organisms, researchers studying recombinant PstC should still consider several ethical and compliance aspects:

  • Biosafety considerations:

    • Ensure appropriate biosafety level containment for recombinant E. coli

    • Follow institutional and national guidelines for recombinant DNA work

    • Properly dispose of genetically modified organisms

    • Maintain accurate records of all recombinant strains created

  • Research integrity:

    • Accurately report all experimental methods and results

    • Acknowledge limitations and potential confounding factors

    • Properly cite previous work on phosphate transport systems

    • Share materials and methods upon reasonable request

  • Collaborative research:

    • Establish clear agreements on intellectual property and authorship

    • Respect confidentiality when reviewing unpublished work

    • Consider open science practices where appropriate

    • Acknowledge contributions of all researchers involved

  • Institutional compliance:

    • Obtain necessary approvals from Institutional Biosafety Committees

    • Register recombinant DNA experiments as required

    • Follow funding agency requirements for data sharing and publication

    • Maintain appropriate documentation of compliance

All recombinant DNA research should comply with local, national, and international regulations governing genetically modified organisms, with appropriate risk assessment conducted before beginning experimental work.

What are the best practices for documentation in PstC research?

Thorough documentation is essential for reproducible and credible research on PstC. Best practices include:

  • Laboratory notebook maintenance:

    • Record all experimental procedures in detail (dates, times, conditions)

    • Document all reagents, including lot numbers and sources

    • Include raw data, calculations, and observations

    • Note unexpected results or deviations from protocols

  • Strain and plasmid documentation:

    • Maintain a comprehensive database of all strains and plasmids

    • Include complete genotype information

    • Document verification tests (sequencing, PCR, phenotype)

    • Establish a clear naming convention

  • Protocol documentation:

    • Write detailed protocols for all routine procedures

    • Update protocols when modifications are made

    • Include troubleshooting notes and optimization history

    • Cross-reference protocols in experimental records

  • Data management:

    • Establish consistent file naming conventions

    • Create backup systems for all digital data

    • Use laboratory information management systems where appropriate

    • Document analysis pipelines and software versions

Proper documentation not only facilitates reproducibility but also helps researchers track the provenance of materials and methods, which is particularly important when working with recombinant proteins like PstC .

What are common challenges in expressing functional PstC?

Researchers often encounter several challenges when expressing recombinant PstC, as it is a membrane protein with complex structure and function:

  • Protein misfolding and aggregation:

    • PstC, being a membrane protein, may aggregate when overexpressed

    • Solution: Lower expression temperature (16-25°C), reduce inducer concentration, or use specialized E. coli strains designed for membrane protein expression

  • Toxicity to host cells:

    • Overexpression of membrane proteins can disrupt membrane integrity

    • Solution: Use tightly regulated expression systems, or balance expression levels through promoter selection and induction optimization

  • Inadequate incorporation into membranes:

    • Inefficient targeting to the membrane can result in cytoplasmic aggregation

    • Solution: Include proper signal sequences, use strains with enhanced membrane protein insertion machinery, or co-express chaperones

  • Verification of functionality:

    • Determining if recombinant PstC is functional can be challenging

    • Solution: Complement pstC deletion strains and verify phosphate transport activity, or use reporter fusions to monitor proper membrane insertion

A methodical approach to optimization, varying parameters systematically and quantifying both expression levels and functional activity, is typically required to overcome these challenges .

How can researchers troubleshoot experiments involving PstC?

When experiments with PstC don't yield expected results, a systematic troubleshooting approach is recommended:

  • Transport assay troubleshooting:

    • Verify phosphate concentrations in media (contaminating phosphate is common)

    • Check cell viability and membrane integrity

    • Confirm expression of all Pst system components

    • Validate assay sensitivity with positive and negative controls

  • Expression troubleshooting:

    • Verify plasmid sequence integrity

    • Check inducer activity and concentration

    • Optimize growth conditions (media, temperature, aeration)

    • Analyze protein expression by Western blot with specific antibodies

  • Functional complementation issues:

    • Ensure complete deletion of chromosomal pstC

    • Verify expression from complementing plasmid

    • Check for plasmid stability and copy number

    • Consider polar effects on downstream genes

  • Strain-specific considerations:

    • Verify strain background (pitA/pitB status)

    • Check for suppressor mutations

    • Consider potential interactions with other transporters

    • Validate Pho regulon status (using reporter strains)

Maintaining detailed records of troubleshooting efforts helps identify patterns and can save time in future experiments. Consulting with researchers experienced in membrane protein work is also valuable when persistent issues arise .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.