Recombinant Escherichia coli Phosphatidylglycerophosphatase B (pgpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli Phosphatidylglycerophosphatase B (pgpB)

Recombinant Escherichia coli phosphatidylglycerophosphate phosphatase B (pgpB) is a membrane-integrated enzyme belonging to the type II phosphatidic acid phosphatase (PAP2) family. It catalyzes the hydrolysis of phosphoric monoester bonds in lipid carriers, such as undecaprenyl pyrophosphate (C55-PP), to generate undecaprenyl phosphate (C55-P), a critical step in bacterial cell wall synthesis and lipid metabolism . The enzyme has been structurally and functionally characterized for its role in dephosphorylating phosphatidylglycerol phosphate (PGP) to phosphatidylglycerol (PG), a major anionic phospholipid in E. coli membranes .

Enzymatic Activity

  • Substrate specificity: Hydrolyzes phosphatidylglycerol phosphate (PGP), farnesyl diphosphate (FPP), and undecaprenyl pyrophosphate .

  • Optimal pH: Activity peaks at neutral pH (7.0–7.5) .

  • Thermal stability: Retains activity up to 45°C, with denaturation occurring at higher temperatures .

Lipid Metabolism

  • Dephosphorylates PGP to PG, a major phospholipid in bacterial membranes .

  • Recycles undecaprenyl pyrophosphate (C55-PP) to undecaprenyl phosphate (C55-P), essential for lipopolysaccharide and peptidoglycan biosynthesis .

Nonessential Gene Status

  • Gene disruption studies show that pgpB is not essential for E. coli viability, as residual phosphatase activity persists in knockout strains .

  • Compensatory enzymes (e.g., YbjG) maintain lipid homeostasis in pgpB-deficient strains .

Farnesol Production

Recombinant pgpB enables the conversion of farnesyl diphosphate (FPP) to farnesol, a valuable sesquiterpenoid:

  • Yield: Overexpression of pgpB with FPP synthase (IspA) and a heterologous mevalonate pathway produced 526.1 mg/L farnesol in E. coli .

  • Mechanism: Hydrolysis of FPP via pgpB’s phosphatase activity bypasses the need for plant-derived farnesol synthase .

Table 2: Farnesol Production Optimization

Strain ModificationFarnesol Yield (mg/L)Key Enzyme(s) Expressed
Wild-type E. coli<10None
pgpB + IspA overexpression526.1pgpB, IspA

Substrate Versatility

  • pgpB hydrolyzes diverse substrates, including FPP and dolichyl pyrophosphates, highlighting its role in isoprenoid metabolism .

Redundancy in Phospholipid Biosynthesis

  • Despite its enzymatic activity, pgpB deletion does not impair PG biosynthesis in vivo, indicating redundant pathways in E. coli .

References to Key Studies

  1. Crystal structure and catalytic mechanism of pgpB ([PMC4040569] , [PNAS] ).

  2. Application in farnesol biosynthesis ([Wiley] ).

  3. Genetic redundancy and nonessential status ([PubMed] ).

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us and we will prioritize its development.
Synonyms
pgpB; b1278; JW1270; Phosphatidylglycerophosphatase B; Diacylglycerol pyrophosphate phosphatase; DGPP phosphatase; Phosphatidate phosphatase; Undecaprenyl pyrophosphate phosphatase; Undecaprenyl-diphosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
pgpB
Target Protein Sequence
MRSIARRTAVGAALLLVMPVAVWISGWRWQPGEQSWLLKAAFWVTETVTQPWGVITHLIL FGWFLWCLRFRIKAAFVLFAILAAAILVGQGVKSWIKDKVQEPRPFVIWLEKTHHIPVDE FYTLKRAERGNLVKEQLAEEKNIPQYLRSHWQKETGFAFPSGHTMFAASWALLAVGLLWP RRRTLTIAILLVWATGVMGSRLLLGMHWPRDLVVATLISWALVAVATWLAQRICGPLTPP AEENREIAQREQES
Uniprot No.

Target Background

Function
Phosphatidylglycerophosphatase B (PgpB) is an enzyme that catalyzes the dephosphorylation of diacylglycerol diphosphate (DGPP) to phosphatidate (PA) and subsequently dephosphorylates PA to diacylglycerol (DAG). It also exhibits undecaprenyl pyrophosphate phosphatase activity, essential for the biosynthesis of the lipid carrier undecaprenyl phosphate. PgpB can utilize lysophosphatidic acid (LPA) and phosphatidylglycerophosphate as substrates. The activity pattern varies based on subcellular location. PGP phosphatase activity is higher in the cytoplasmic membrane, while PA and LPA phosphatase activities are more prominent in the outer membrane. Its activity is independent of divalent cation ions and is not inhibited by N-ethylmaleimide.
Gene References Into Functions
  1. These studies unveil new mechanisms of lipid substrate selection and catalysis by PgpB, suggesting that the enzyme exists in a PE-stabilized state within the bilayer. PMID: 27405756
  2. This research analyzes the substrate specificity and membrane topology of Escherichia coli PgpB, an undecaprenyl pyrophosphate phosphatase. PMID: 18411271
Database Links
Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Cell outer membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of E. coli phosphatidylglycerophosphatase B (pgpB)?

Phosphatidylglycerol-phosphate phosphatase B (pgpB) from E. coli is a membrane-integrated enzyme belonging to the type II phosphatidic acid phosphatase (PAP2) family. The crystal structure, determined at 3.2 Å resolution, reveals that pgpB contains multiple transmembrane helices with the active site positioned to allow lateral substrate access from the membrane lipid bilayer. The structure shares similar folding topology with soluble PAP2 enzymes but has a unique substrate binding mechanism adapted for membrane-bound substrates . The protein includes peptide segments spanning residues 2-32, 35-139, 144-239, and 242-254, with some regions omitted in the structural model due to weak electron density. The crystal form is classified as a type I membrane protein crystal with transmembrane helices aligned along the crystallographic c axis .

What is the primary function of pgpB in E. coli?

E. coli pgpB catalyzes the removal of the terminal phosphate group from lipid carriers, most notably undecaprenyl pyrophosphate . This dephosphorylation activity is essential for the transport of various hydrophilic small molecules across the bacterial membrane. As a membrane-integrated phosphatase, pgpB plays a crucial role in phospholipid metabolism and membrane homeostasis. The enzyme shares functional similarities with human glucose-6-phosphatase, suggesting evolutionary conservation of the catalytic mechanism across species boundaries despite differences in cellular localization and substrate specificity .

What are the optimal conditions for expressing recombinant pgpB in E. coli?

For optimal expression of recombinant pgpB in E. coli, researchers should consider the following methodological approach:

  • Strain selection: Choose E. coli strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3).

  • Growth media optimization: For high-yield protein production, M9 minimal medium supplemented with glucose (20 g/L) and trace elements is recommended . This controlled environment helps maintain consistent protein quality.

  • Genetic modifications: Consider using strains with mutations in the glucose transport system (ptsG knockout) combined with flagella regulator modifications (flhC deletion) to enhance recombinant protein yields. These modifications help redirect cellular energy toward protein production by reducing energy expenditure on motility and altering metabolic flux .

  • Expression vector design: Incorporate a strong inducible promoter (such as T7 or pTrc) and optimize codon usage for membrane proteins. Include appropriate fusion tags for detection and purification while being mindful of potential impacts on membrane insertion.

  • Temperature and induction conditions: Lower temperatures (16-25°C) often improve membrane protein folding. Induction with reduced concentrations of IPTG (0.1-0.5 mM) for extended periods (16-24 hours) typically yields better results than strong induction at higher temperatures.

What purification strategies yield the highest purity of functional pgpB?

A multi-step purification strategy is recommended to obtain high-purity functional pgpB:

  • Membrane isolation: After cell lysis (preferably using a pressure-based system like French press or microfluidizer), isolate membrane fractions through differential centrifugation. Wash membranes with carbonate buffer to remove peripherally associated proteins.

  • Solubilization: Carefully select detergents that maintain pgpB activity. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration (CMC) are recommended for membrane protein extraction.

  • Affinity chromatography: Utilizing His-tagged constructs, perform immobilized metal affinity chromatography (IMAC) with imidazole gradient elution. For pgpB specifically, ensure all buffers contain the selected detergent at concentrations above CMC to prevent protein aggregation .

  • Size exclusion chromatography: As a final polishing step, size exclusion chromatography separates any remaining contaminants and aggregates, while simultaneously performing buffer exchange if needed.

  • Quality assessment: Evaluate protein purity using SDS-PAGE and Western blotting. Functional assessment through phosphatase activity assays using appropriate lipid substrates is essential to confirm that the purified protein maintains its catalytic activity.

How has the crystal structure of pgpB been determined and what are the key findings?

The crystal structure of E. coli pgpB was determined using X-ray crystallography at a resolution of 3.2 Å . The methodological approach involved:

  • Crystallization: The protein crystallized in the P12₁1 space group with one protein molecule per asymmetrical unit and 60% solvent content (Matthews coefficient of 3.1 ų/Da) .

  • Data collection and processing: X-ray diffraction data were collected and processed to determine the structural model, with refinement statistics including an Rwork of 27.0% and Rfree of 30.2% .

  • Structure refinement: The final model included peptide segments covering residues 2-32, 35-139, 144-239, and 242-254, with some regions omitted due to weak electron density .

Key structural findings include:

  • The transmembrane helices are aligned along the crystallographic c axis, characteristic of a type I membrane protein crystal .

  • The structure shares similar folding topology and nearly identical active site architecture with soluble PAP2 enzymes, suggesting conservation of the catalytic mechanism .

  • Unlike soluble PAP2 enzymes, the substrate binding mechanism appears fundamentally different. In pgpB, the potential substrate entrance to the active site is located in a cleft formed by a V-shaped transmembrane helix pair, allowing lateral movement of lipid substrates from the membrane bilayer to the active site .

  • The structure contains no disulfide bonds, with one partially buried cysteine residue (Cys67) and one solvent-exposed cysteine (Cys234) .

  • The structural data suggests an induced-fit mechanism for substrate binding, providing insights into how membrane-integrated phosphatases interact with lipid substrates.

What advanced spectroscopic methods are most informative for studying pgpB dynamics?

For investigating the dynamic aspects of pgpB structure and function, several advanced spectroscopic methods are particularly valuable:

  • Nuclear Magnetic Resonance (NMR) spectroscopy: For membrane proteins like pgpB, solution NMR with isotope labeling (¹⁵N, ¹³C) can provide information about local dynamics and substrate interactions. Solid-state NMR is particularly valuable for studying membrane proteins in a lipid environment that more closely resembles their native state.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique provides information about protein dynamics and solvent accessibility by measuring the rate at which backbone amide hydrogens exchange with deuterium. For membrane proteins like pgpB, HDX-MS can reveal conformational changes associated with substrate binding or catalysis.

  • Electron Paramagnetic Resonance (EPR) spectroscopy: Site-directed spin labeling combined with EPR can provide detailed information about the dynamic behavior of specific regions of the protein, particularly useful for studying the conformational changes in the transmembrane helices forming the substrate entrance cleft.

  • Fluorescence spectroscopy: Introducing fluorescent probes at strategic positions can monitor conformational changes during catalysis. Techniques like Förster Resonance Energy Transfer (FRET) can measure distances between labeled positions, providing insights into the dynamics of substrate binding and product release.

  • Time-resolved crystallography: Although technically challenging, this method can capture different conformational states during the catalytic cycle, providing a movie-like understanding of how pgpB functions.

What assays are most reliable for measuring pgpB phosphatase activity?

Several reliable assays for measuring pgpB phosphatase activity include:

  • Malachite Green Assay: This colorimetric method detects inorganic phosphate (Pi) released during the phosphatase reaction. The assay is performed by incubating purified pgpB with its lipid substrate in detergent micelles or liposomes, followed by addition of malachite green reagent. The intensity of the green color formed is proportional to the amount of released phosphate and can be quantified spectrophotometrically.

  • Radioactive Assay: Using ³²P-labeled substrates (such as [³²P]-phosphatidylglycerol phosphate), the release of radioactive phosphate can be measured. After separation of reaction products by thin-layer chromatography or extraction, the amount of radioactive phosphate released is quantified by scintillation counting.

  • Fluorescence-based Assays: Artificial substrates with fluorogenic leaving groups can be used to continuously monitor enzyme activity. When the phosphate group is removed, the fluorophore is released, resulting in increased fluorescence.

  • Coupled Enzyme Assays: The released phosphate can be linked to other enzyme reactions that produce a measurable signal, allowing real-time monitoring of activity.

  • Activity in Reconstituted Systems: For more physiologically relevant measurements, pgpB can be reconstituted into liposomes or nanodiscs, and activity measured using lipid substrates incorporated into these membrane mimetics.

When evaluating point mutations, activity assays have confirmed the importance of catalytic residues and those involved in phosphate binding, providing insights into the enzyme's mechanism .

How does the membrane environment affect pgpB activity and substrate specificity?

The membrane environment significantly influences pgpB activity and substrate specificity through several mechanisms:

  • Lipid composition effects: The lipid composition of the membrane affects enzyme activity by influencing:

    • Membrane fluidity and thickness, which can impact the positioning of the active site relative to substrates

    • Surface charge distribution, affecting substrate recruitment

    • Lateral pressure within the membrane, which may alter protein conformation

  • Substrate accessibility: The V-shaped transmembrane helix pair forms a cleft allowing lateral movement of lipid substrates from the membrane bilayer into the active site . This arrangement facilitates access to membrane-embedded substrates while limiting accessibility to soluble molecules.

  • Induced-fit mechanism: Structural analysis suggests an induced-fit mechanism for substrate binding , where interaction with the substrate causes conformational changes in the enzyme. The membrane environment likely influences these conformational dynamics.

  • Substrate orientation: The membrane helps to orient lipid substrates correctly for catalysis, with the phosphate group properly positioned relative to the active site.

  • Regulatory effects: Membrane composition can serve as an allosteric regulator of enzyme activity, with certain lipids potentially enhancing or inhibiting pgpB function depending on cellular conditions.

These environmental factors should be carefully considered when designing in vitro assays to accurately reflect the native activity of pgpB.

What strategies can improve recombinant pgpB expression yields?

Several genetic engineering strategies can significantly improve recombinant pgpB expression yields:

  • Metabolic burden reduction: Knocking out the ptsG gene (encoding glucose transporter) reduces overflow metabolism and redirects carbon flux toward biomass and recombinant protein production. This modification leads to reduced glucose uptake rate, upregulated tricarboxylic acid (TCA) cycle, and suppressed acetate production .

  • Energy conservation through flagella modification: Deleting the flhC gene (encoding a master regulator for flagellar assembly) reduces energy expenditure on motility, making more resources available for protein synthesis. When combined with ptsG knockout, this approach has demonstrated increased yields of recombinant proteins .

  • Plasmid optimization: Using high copy number plasmids in the ptsG/flhC double knockout mutant has been shown to restore growth rates while maintaining high recombinant protein yields. This approach effectively balances the cellular energy distribution .

  • Codon optimization: Adapting the pgpB gene sequence to the preferred codon usage of E. coli can significantly improve translation efficiency.

  • Fusion partners and solubility tags: For membrane proteins like pgpB, fusion with appropriate tags can improve expression, proper membrane insertion, and subsequent purification.

  • Optogenetic regulation: Implementing light-controlled expression systems such as the blue-light activation tool (BLAT) or near-infrared light activation tool (NRAT) allows precise temporal control of protein expression. These systems can regulate cell division periods (C and D periods), which can be optimized to enhance protein production .

How can pgpB be engineered for altered substrate specificity or improved stability?

Engineering pgpB for altered substrate specificity or improved stability requires targeted approaches:

  • Structure-guided mutagenesis: Based on the crystal structure of pgpB , residues in the active site or substrate-binding cleft can be selectively modified to:

    • Alter the size or hydrophobicity of the binding pocket to accommodate different substrates

    • Modify charged residues involved in substrate recognition to change specificity

    • Strengthen interactions with the phosphate group for improved binding

  • Directed evolution: Implementing random mutagenesis followed by selection for variants with desired properties can identify unexpected improvements in stability or specificity.

  • Chimeric enzymes: Creating fusion proteins that combine domains from pgpB with those from related phosphatases might generate enzymes with novel substrate preferences.

  • Disulfide bond engineering: Introducing strategic disulfide bonds can enhance thermostability. While the native pgpB structure contains no disulfide bonds , introducing them at appropriate positions could stabilize flexible regions.

  • Computational design: Using molecular modeling to predict mutations that might improve stability or alter substrate specificity, followed by experimental validation.

  • Membrane-mimetic adaptations: Modifying the transmembrane regions to optimize interaction with specific membrane environments or detergents can improve stability during purification and handling.

  • Loop modifications: Engineering the solvent-exposed loops connecting the transmembrane segments to be more rigid or compact can enhance thermal stability while potentially preserving catalytic function.

When testing engineered variants, thermal stability assays and activity measurements with various substrates should be conducted to comprehensively characterize the modified enzymes.

How can metabolic flux analysis be applied to optimize pgpB expression systems?

¹³C-Metabolic Flux Analysis (¹³C-MFA) is a powerful tool for optimizing pgpB expression systems, providing insights into cellular metabolism and energy utilization patterns. This approach involves:

  • Experimental setup: Cultivate E. coli strains expressing pgpB with ¹³C-labeled glucose as the carbon source. The distribution of isotope labels in metabolites reveals the activity of different metabolic pathways .

  • Analysis of key pathway fluxes: Measure flux through:

    • Glycolysis

    • Pentose phosphate pathway (important for NADPH generation)

    • TCA cycle (energy production)

    • Anabolic pathways

  • Energy and cofactor balance: Measure intracellular concentrations of ATP, NADH, and NADPH to assess energy status in different strains. In modified strains like those with flagella gene deletions (flhC), accumulation of ATP and NADPH that would otherwise be used for flagella assembly can be redirected to protein synthesis .

  • Strain optimization strategy: Based on flux analysis results, implement further genetic modifications to optimize metabolic balance. For example, introducing plasmids that consume excess ATP and NADPH in flhC deletion strains has been shown to restore growth while maintaining high protein yields .

  • Overflow metabolism control: Monitor and minimize acetate production, which occurs when carbon flux exceeds the capacity of the TCA cycle. Strains with ptsG mutation show suppressed acetate production, contributing to improved recombinant protein yields .

  • Iterative optimization: Use each round of flux analysis to guide subsequent genetic modifications, creating progressively more efficient expression systems.

This systematic approach helps identify metabolic bottlenecks and implement targeted improvements to maximize pgpB production while maintaining cellular health.

What are the challenges in crystallizing membrane proteins like pgpB and how can they be overcome?

Crystallizing membrane proteins like pgpB presents several significant challenges and corresponding solutions:

  • Protein stability and homogeneity challenges:

    • Challenge: Membrane proteins often denature or aggregate when removed from their native lipid environment.

    • Solution: Screen multiple detergents or use newer amphipathic agents like nanodiscs, amphipols, or lipidic cubic phases that better mimic the membrane environment. For pgpB specifically, the successful crystal structure determination suggests compatible detergent systems have been identified .

  • Crystal packing limitations:

    • Challenge: The hydrophobic transmembrane regions limit crystal contact formation.

    • Solution: Use antibody fragments or fusion partners that increase hydrophilic surface area. The pgpB crystals formed with transmembrane helices aligned along the crystallographic c axis (type I membrane protein crystal) , indicating successful crystal packing strategies.

  • Conformational heterogeneity:

    • Challenge: Membrane proteins often exist in multiple conformational states.

    • Solution: Use ligands, inhibitors, or mutations to trap the protein in a specific conformation. The induced-fit mechanism observed in pgpB suggests conformational stabilization may be achieved through substrate analogs.

  • Lipid requirements:

    • Challenge: Specific lipids may be required for stability or function.

    • Solution: Incorporate native or synthetic lipids during purification and crystallization.

  • Phase separation during crystallization:

    • Challenge: Detergents can phase-separate during crystallization attempts.

    • Solution: Carefully optimize detergent concentration, temperature, and precipitant conditions.

  • Diffraction quality:

    • Challenge: Membrane protein crystals often diffract poorly.

    • Solution: Extensive screening of crystallization conditions, post-crystallization treatments, and data collection at microfocus beamlines. The pgpB structure was determined at 3.2 Å resolution , indicating moderate diffraction quality that could potentially be improved.

  • Data analysis complexities:

    • Challenge: Membrane protein datasets can be challenging to process and interpret.

    • Solution: Apply advanced data processing techniques and molecular replacement using structural homologs when available.

How can transcriptomics and proteomics enhance our understanding of pgpB function?

Integrating transcriptomics and proteomics approaches can provide comprehensive insights into pgpB function and regulation:

  • Transcriptomics applications:

    • Expression profiling: RNA-seq analysis can identify conditions that naturally upregulate or downregulate pgpB expression, providing clues about its physiological roles.

    • Regulatory network mapping: Identifying transcription factors and small RNAs that regulate pgpB expression helps understand its place in cellular response networks.

    • Alternative splicing detection: High-throughput transcriptional sequencing can reveal potential alternative transcripts of pgpB or related genes under different conditions .

    • Response to genetic modifications: Transcriptome analysis of strains with pgpB overexpression or deletion can reveal compensatory changes and downstream effects, illuminating its functional network.

  • Proteomics contributions:

    • Protein-protein interaction studies: Techniques like affinity purification-mass spectrometry can identify proteins that physically interact with pgpB, revealing potential regulatory partners or multiprotein complexes.

    • Post-translational modifications: Mass spectrometry can identify modifications on pgpB that might regulate its activity or localization.

    • Quantitative proteomics: Measuring changes in the abundance of other proteins in response to pgpB manipulation helps map its influence on cellular processes.

    • Membrane proteome analysis: Specialized membrane proteomics techniques can place pgpB in the context of the complete membrane protein landscape.

  • Integrated approaches:

    • Multi-omics data integration: Combining transcriptomic and proteomic datasets provides a more complete picture of how pgpB functions within cellular networks.

    • Systems biology modeling: Data from both approaches can inform computational models of membrane homeostasis and phospholipid metabolism.

These omics approaches are particularly powerful when applied to compare wild-type and engineered strains, or to examine responses to environmental stressors that might influence pgpB function.

What bioinformatic tools are most useful for analyzing evolutionary conservation of pgpB across bacterial species?

Several specialized bioinformatic tools and approaches are particularly valuable for analyzing pgpB evolutionary conservation:

  • Sequence alignment and phylogenetic analysis:

    • MUSCLE or MAFFT: For creating multiple sequence alignments of pgpB homologs

    • RAxML or MrBayes: For constructing phylogenetic trees to visualize evolutionary relationships

    • ConSurf: For mapping conservation scores onto protein structures, revealing functionally important regions

  • Structural bioinformatics:

    • DALI or TM-align: For comparing the pgpB crystal structure with other phosphatases to identify structural conservation beyond sequence similarity

    • FoldX or Rosetta: For computational analysis of how mutations might affect protein stability across different species variants

    • 3DLigandSite: For predicting conserved ligand binding sites across homologs

  • Functional site prediction:

    • ScanProsite or MOTIF: For identifying conserved functional motifs

    • ConFunc or INTREPID: For predicting functionally important residues from sequence alignments

    • MutPred or SIFT: For assessing the potential impact of amino acid substitutions on protein function

  • Genomic context analysis:

    • DOOR or MicrobesOnline: For analyzing the conservation of gene neighborhoods around pgpB

    • STRING or GeneMANIA: For examining conserved functional associations

  • Specialized membrane protein tools:

    • TOPCONS: For predicting and comparing transmembrane topology across homologs

    • PPM server: For positioning protein structures in membranes

    • TMHMM or MEMSAT: For transmembrane helix prediction and comparison

  • Whole genome analysis approaches:

    • OrthoMCL or OMA: For identifying orthologs across bacterial genomes

    • CAFE: For analyzing gene family evolution rates

    • PAML: For detecting sites under positive or negative selection

These tools can help identify conserved catalytic residues, substrate binding motifs, and membrane interaction domains, providing insights into the evolutionary constraints on pgpB structure and function across bacterial species.

What are the emerging technologies for studying membrane proteins like pgpB?

Several cutting-edge technologies are revolutionizing membrane protein research, with important applications for studying pgpB:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle cryo-EM now achieves near-atomic resolution for membrane proteins without crystallization

    • Particularly valuable for capturing different conformational states of pgpB during its catalytic cycle

    • Can visualize pgpB in more native-like environments such as nanodiscs or liposomes

  • Advanced mass spectrometry techniques:

    • Native mass spectrometry for intact membrane protein complexes

    • Cross-linking mass spectrometry (XL-MS) to map protein interactions and conformations

    • Ion mobility-mass spectrometry to study protein dynamics and conformational changes

  • Single-molecule techniques:

    • Single-molecule FRET to track conformational changes during catalysis

    • Atomic force microscopy (AFM) for direct visualization and manipulation of pgpB in membranes

    • Optical tweezers to measure forces associated with substrate binding and product release

  • Microfluidics and lab-on-a-chip approaches:

    • High-throughput screening of conditions for protein stability and activity

    • Droplet-based assays for enzyme kinetics with minimal sample consumption

    • Gradient formation for studying membrane protein behavior across varying conditions

  • Computational advances:

    • Molecular dynamics simulations of pgpB in explicit membrane environments over extended timescales

    • Machine learning approaches for predicting protein-substrate interactions

    • Quantum mechanics/molecular mechanics (QM/MM) simulations of the catalytic mechanism

  • In-cell structural biology:

    • In-cell NMR to study pgpB structure and dynamics in living cells

    • Genetically encoded sensors for monitoring pgpB activity in real-time

    • Optogenetic approaches for temporal control of pgpB expression and function

  • Genome editing and synthetic biology:

    • CRISPR-Cas9 for precise genomic integration or modification of pgpB

    • Cell-free expression systems optimized for membrane proteins

    • Designed minimal cells for studying essential functions of pgpB

What are the potential applications of understanding pgpB structure and function for broader biological research?

Understanding pgpB structure and function has significant implications for broader biological research:

  • Model system for membrane enzyme mechanisms:

    • pgpB serves as an excellent model for studying how membrane-integrated enzymes interact with lipid substrates

    • The V-shaped transmembrane helix pair that forms the substrate entrance cleft provides insights into general principles of membrane protein-substrate interactions

    • The induced-fit mechanism suggested by structural studies contributes to understanding dynamics of membrane enzymes

  • Antibiotic development insights:

    • As pgpB catalyzes essential steps in bacterial membrane lipid metabolism, structural insights could inform the design of novel antibiotics

    • The differences between bacterial pgpB and human phosphatases can be exploited for selective targeting

    • Understanding substrate recognition mechanisms helps in designing competitive inhibitors

  • Biotechnology applications:

    • Engineered pgpB variants could serve as biocatalysts for the synthesis of specialized phospholipids

    • The protein engineering strategies developed for pgpB could be applied to other membrane enzymes

    • Expression optimization techniques using metabolic flux analysis provide broader strategies for recombinant protein production

  • Membrane biology fundamentals:

    • pgpB studies contribute to understanding membrane homeostasis and remodeling

    • The relationship between membrane composition and enzyme function informs broader membrane biology concepts

    • Techniques developed for pgpB research advance methods for studying other membrane components

  • Evolutionary insights:

    • Comparison of pgpB with human glucose-6-phosphatase and other PAP2 family members illuminates evolutionary relationships between membrane and soluble phosphatases

    • Conservation analysis helps identify fundamental principles of phosphatase catalysis across domains of life

  • Synthetic biology tools:

    • Engineered pgpB variants could serve as components in synthetic membrane systems

    • The optogenetic regulation strategies developed for E. coli could be adapted for spatial and temporal control of pgpB and other proteins in synthetic biological circuits

  • Medical research connections:

    • Understanding the bacterial phosphatase mechanisms informs research on human phosphatases implicated in diseases

    • The structural similarities between pgpB and human phosphatases provide templates for modeling human enzymes that are challenging to study directly

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.