Recombinant Escherichia coli Phosphoethanolamine transferase CptA (cptA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli Phosphoethanolamine Transferase CptA (CptA)

Phosphoethanolamine transferase CptA (CptA) is a chromosomally encoded enzyme in E. coli that modifies the lipopolysaccharide (LPS) core by transferring phosphoethanolamine (pEtN) to specific sites, enhancing bacterial resistance to antimicrobials like colistin. As part of the intrinsic lipid modification phosphoethanolamine transferase (i-PET) family, CptA works alongside EptA and EptB to engineer the LPS structure, altering outer membrane permeability and pathogenicity . Recombinant production of CptA in E. coli has enabled structural and functional studies, revealing its critical role in antibiotic resistance and membrane homeostasis.

Structure and Functional Mechanism of CptA

CptA shares a conserved architecture with other i-PET enzymes:

  • Transmembrane Domain: Anchors the enzyme to the inner membrane.

  • Soluble Catalytic Domain: Contains zinc-coordinated active sites for substrate binding and catalysis .

Catalytic Specificity and Substrate Binding

CptA transfers pEtN from phosphatidylethanolamine (PE) donors to the second heptose (Hep II) of the LPS core . This modification reduces the LPS’s negative charge, weakening interactions with cationic antimicrobials like colistin .

Key Residues and Zinc Coordination

CptA’s catalytic activity depends on conserved residues:

ResidueRoleConserved Across i-PET Enzymes?
Thr266 (EptC)Catalytic nucleophilePartially conserved (Thr280 in EptA, Thr285 in MCR-1)
Glu227, Asp427, His428Zinc coordination (first pocket)Yes (critical for structural stability)
His466Zinc coordination (second pocket)No (absent in EptC)

Zinc is essential for maintaining the enzyme’s active conformation and facilitating substrate binding .

Membrane Lipid Homeostasis

CptA’s activity is tightly regulated by the surrounding lipid environment:

  • Phosphatidylethanolamine (PE) Availability: Excessive PE consumption disrupts membrane stability, necessitating feedback control .

  • Conformational Dynamics: Molecular dynamics simulations (though focused on EptA) suggest that membrane lipid composition modulates CptA’s conformational transitions between closed (inactive) and open (active) states .

Enzymatic Regulation

CptA follows a ping-pong mechanism:

  1. PE Binding: PE acts as a donor, transferring pEtN to the enzyme.

  2. LPS Modification: The pEtN group is transferred to Hep II of the LPS core .

Recombinant Production and Challenges

CptA is heterologously expressed in E. coli using optimized systems:

ParameterOptimal ConditionsExample Strains/Plasmids
Expression VectorHigh-copy plasmids (e.g., pET series)pET28a with His-tag
Host StrainsBL21(DE3) pLysS (represses leaky expression)Recombinant strains with chaperones
InductionIPTG (0.1–1 mM) at 16–20°CSlower growth reduces inclusion body formation

Key Challenges

  • Inclusion Body Formation: High expression levels often lead to misfolded protein aggregates.

  • Lack of Chaperones: Requires co-expression with bacterial chaperones (e.g., GroEL/GroES) for proper folding.

Role in Antibiotic Resistance

CptA-mediated LPS modifications reduce colistin binding efficacy. For example:

  • Colistin MIC: E. coli strains lacking CptA show heightened sensitivity to colistin (MIC increases) .

  • Pathogen Survival: CptA-deficient mutants exhibit reduced adhesion to host cells and increased susceptibility to host defenses (e.g., complement, phagocytosis) .

Comparative Analysis of i-PET Enzymes

EnzymeTarget SiteSubstrate SpecificityZinc Dependency
EptALipid A (N-acetylglucosamine)Re LPSYes
EptBKDO IIRe LPSYes
CptAHep IIRe LPSYes

CptA shares <26% sequence identity with EptA/EptB, reflecting divergent evolutionary pressures .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
eptC; cptA; yijP; b3955; JW3927; Phosphoethanolamine transferase EptC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-577
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
eptC
Target Protein Sequence
MHSTEVQAKPLFSWKALGWALLYFWFFSTLLQAIIYISGYSGTNGIRDSLLFSSLWLIPV FLFPKRIKIIAAVIGVVLWAASLAALCYYVIYGQEFSQSVLFVMFETNTNEASEYLSQYF SLKIVLIALAYTAVAVLLWTRLRPVYIPKPWRYVVSFALLYGLILHPIAMNTFIKNKPFE KTLDNLASRMEPAAPWQFLTGYYQYRQQLNSLTKLLNENNALPPLANFKDESGNEPRTLV LVIGESTQRGRMSLYGYPRETTPELDALHKTDPNLTVFNNVVTSRPYTIEILQQALTFAN EKNPDLYLTQPSLMNMMKQAGYKTFWITNQQTMTARNTMLTVFSRQTDKQYYMNQQRTQS AREYDTNVLKPFQEVLNDPAPKKLIIVHLLGTHIKYKYRYPENQGKFDGNTDHVPPGLNA EELESYNDYDNANLYNDHVVASLIKDFKAANPNGFLVYFSDHGEEVYDTPPHKTQGRNED NPTRHMYTIPFLLWTSEKWQATHPRDFSQDVDRKYSLAELIHTWSDLAGLSYDGYDPTRS VVNPQFKETTRWIGNPYKKNALIDYDTLPYGDQVGNQ
Uniprot No.

Target Background

Function
Catalyzes the addition of a phosphoethanolamine moiety to the outer membrane lipopolysaccharide core.
Database Links
Protein Families
Phosphoethanolamine transferase family, EptC/CptA subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoethanolamine transferase CptA and what organisms produce it?

Phosphoethanolamine transferase CptA is a protein that catalyzes the addition of phosphoethanolamine (PEtn) groups to bacterial cell surface molecules. While initially characterized in Sneathia amnii as a cytopathogenic toxin with pore-forming activity, similar proteins have been identified in several Gram-negative bacteria . In E. coli strain K12, CptA (UniProt ID: P0CB39) functions as a phosphoethanolamine transferase . This protein represents a member of a broader family of PEtn transferases found across various bacterial species, including those in the genera Vibrio, Bordetella, and Haemophilus .

The CptA from S. amnii is a large protein with a predicted size of approximately 200 kDa, featuring distinct structural domains and repeat regions. Specifically, the C-terminal third contains a series of 5 repeats, 3 of which are 79 amino acids in length, sharing 100% identity, and oriented in tandem . This structural arrangement contributes to the protein's functional properties and may play a role in its interaction with cellular membranes.

How does recombinant CptA differ functionally from native CptA?

Comparative functional analysis between recombinant and native CptA reveals important insights for experimental design considerations:

ParameterNative CptARecombinant CptAMethodological Implications
Hemolytic ActivityPresentHigher activity per unit proteinStandardization of activity units required for cross-study comparisons
Molecular Weight BandsMultiple bands (72-250 kDa)Multiple bands (40-240 kDa)Western blot analysis should account for processing fragments
PurityVariableHigher when affinity-purifiedActivity assessments must consider purity differences
Post-translational ModificationsPresentMay differ based on expression systemFunctional validation necessary for each preparation

Recombinant CptA exhibits hemolytic activity significantly greater than native CptA, likely due to higher purity of the recombinant protein preparations rather than intrinsic differences in molecular function . This observation highlights the importance of standardizing activity measurements when comparing different protein preparations. The cytotoxic effects of both native and recombinant CptA can be neutralized by specific antisera, confirming their antigenic similarity despite potential differences in post-translational modifications .

What experimental approaches can be used to characterize CptA pore-forming activity?

The pore-forming activity of CptA can be characterized through multiple complementary approaches:

Hemolysis Assays

Red blood cell (RBC) lysis assays provide a quantitative measure of CptA's pore-forming capability. This approach involves:

  • Incubating purified CptA or recombinant CptA with human RBCs

  • Measuring hemoglobin release spectrophotometrically

  • Calculating the percentage of hemolysis relative to complete lysis controls

  • Determining concentration-dependent effects through titration experiments

Research has demonstrated that both CptA and recombinant CptA liberate hemoglobin from RBCs within 1 hour of treatment, indicating rapid pore formation .

Pore Size Determination

Polyethylene glycol (PEG) protection assays can determine the approximate size of pores formed by CptA:

  • Pre-incubating RBCs with PEGs of different molecular weights

  • Adding CptA and measuring hemolysis inhibition

  • Correlating PEG size with protection efficacy

Studies have shown that PEG 1000 inhibits CptA-mediated hemolysis while PEG 500 does not, indicating pore sizes on the order of 2.0 to 2.8 nm . This methodological approach places CptA-formed pores in the size range similar to alpha- and gamma-toxins, but considerably smaller than cholesterol-dependent cytolysins.

Cell Permeability Assays

Trophoblast permeability measurements using trypan blue exclusion provide insights into CptA's effects on nucleated cells:

  • Treating JEG-3 chorionic trophoblast monolayers with CptA

  • Assessing cell viability via MTT assay

  • Quantifying membrane permeabilization through trypan blue uptake

  • Evaluating protective effects of anti-CptA antibodies

These methodological approaches collectively provide a comprehensive assessment of CptA's pore-forming capability across different cellular targets and experimental conditions.

What are the optimal conditions for expressing and purifying recombinant CptA?

Successful expression and purification of recombinant CptA requires careful optimization:

Expression Systems

The most commonly employed system is E. coli, using vectors such as pET32a for histidine-tagged protein production . Key considerations include:

  • Selection of appropriate E. coli strains (K12 derivatives commonly used)

  • Optimization of induction conditions (temperature, IPTG concentration, duration)

  • Addressing potential toxicity to the host through regulated expression

  • Determining full-length vs. domain-specific constructs based on research objectives

Purification Strategies

Affinity chromatography using histidine tags represents the primary purification approach:

  • Immobilized metal affinity chromatography (IMAC) with nickel or cobalt resins

  • Buffer optimization to maintain protein stability and activity

  • Additional purification steps (ion exchange, size exclusion) as needed

  • Quality control via SDS-PAGE and Western blotting

Storage Conditions

Optimal storage conditions based on available product information include:

  • Short-term storage: Tris-based buffer at 4°C for up to one week

  • Long-term storage: 50% glycerol at -20°C or -80°C

  • Avoidance of repeated freeze-thaw cycles

  • Validation of activity after extended storage periods

These methodological details provide researchers with practical guidelines for obtaining functional recombinant CptA suitable for diverse experimental applications.

How do you assess and quantify the biological activity of recombinant CptA?

Quantitative assessment of recombinant CptA activity employs multiple complementary approaches:

Functional Assays

Assay TypeMethodologyQuantification MethodTypical Timeframe
HemolysisHuman RBC incubationSpectrophotometric measurement of released hemoglobin1-3 hours
Cell ViabilityJEG-3 trophoblast treatmentMTT reduction assay24-48 hours
Membrane PermeabilityTrophoblast cell cultureTrypan blue uptake quantification1-24 hours
Antibody NeutralizationPre-incubation with anti-CptAInhibition of cytotoxic effectsVariable

These assays should include appropriate controls:

  • Positive controls using known concentrations of active protein

  • Negative controls with buffer alone

  • Specificity controls using preimmune serum versus specific antisera

  • Dose-response analyses to establish activity parameters

Molecular Characterization

Western blot analysis using anti-CptA antibodies reveals characteristic patterns of protein processing. Native CptA typically appears as multiple bands ranging from approximately 72 to 250 kDa, while recombinant preparations show bands from 40 to 240 kDa . This pattern likely reflects protein processing rather than degradation, as similar patterns are observed in both native and recombinant preparations.

Two-Partner Secretion (TPS) System

CptA functions as part of a two-partner secretion system:

  • CptA serves as the "A" component (passenger protein)

  • CptB functions as the transporter component (approximately 51 kDa, 441 amino acids)

  • CptB shares only 16% amino acid identity with the FhaC transporter of B. pertussis

  • In silico structural analysis indicates high structural similarity despite low sequence homology

Structural Domains

The molecular architecture of CptA includes distinct functional domains:

  • N-terminal region containing conserved domains found in TPS passenger proteins

  • Central region harboring cytotoxic activity

  • C-terminal region featuring repetitive elements (79 amino acid perfect repeats)

  • Limited sequence homology with known toxins except for small conserved domains

Mechanistic Model

Based on experimental evidence, CptA appears to function through the following mechanism:

  • Secretion via the CptB transporter

  • Binding to target cell membranes

  • Oligomerization and insertion into membranes

  • Formation of defined pores (2.0-2.8 nm diameter)

  • Cellular permeabilization leading to osmotic lysis or metabolic disruption

This mechanistic understanding provides a framework for designing targeted interventions and developing experimental approaches to further characterize CptA function.

How does CptA relate to other bacterial phosphoethanolamine transferases?

Phosphoethanolamine transferases represent a diverse family of enzymes with important roles in bacterial membrane structure and antimicrobial resistance:

Evolutionary Relationships

Phylogenetic analysis places CptA within a broader context of bacterial PEtn transferases:

  • PetK represents the first characterized member of a distinct family of predicted PEtn transferases

  • This family includes uncharacterized proteins from diverse Gram-negative bacteria

  • Common feature: production of LPS glycoforms with only one Kdo molecule

  • Distribution across pathogenic species including Vibrio, Bordetella, and Haemophilus

Functional Comparisons

Comparative analysis with other characterized PEtn transferases reveals:

  • PetL and PetK in P. multocida catalyze PEtn addition to specific positions in lipopolysaccharide

  • These modifications are essential for resistance to cationic antimicrobial peptides like cathelicidin-2

  • The presence of PEtn on lipid A and Kdo significantly enhances antimicrobial resistance

  • Similar modifications likely occur across multiple pathogenic species

This comparative perspective provides important context for understanding the broader significance of CptA within bacterial physiology and pathogenesis.

What are the key experimental challenges when working with recombinant CptA?

Researchers face several methodological challenges when working with recombinant CptA:

Protein Size and Stability

The large size of full-length CptA (approximately 200 kDa) presents challenges for:

  • Complete expression of the intact protein

  • Purification of homogeneous preparations

  • Maintaining stability during storage and experimental manipulation

  • Distinguishing between processed forms and degradation products

Activity Assessment

Standardization of activity measurements requires addressing:

  • Variation in specific activity between preparations

  • Processing of the protein into multiple active forms

  • Potential differences between recombinant and native protein

  • Selection of appropriate cellular targets for functional assays

Structural Analysis

Determination of CptA's three-dimensional structure faces obstacles including:

  • Size limitations for conventional structural biology techniques

  • Presence of repetitive elements complicating sequence analysis

  • Limited homology with well-characterized proteins

  • Potential conformational changes upon membrane interaction

Addressing these challenges requires integrated experimental approaches combining biochemical, cellular, and structural methodologies.

How can researchers validate the specificity of observed CptA effects?

Establishing specificity is critical for accurate interpretation of experimental results:

Antibody Neutralization

Anti-CptA antibodies provide powerful tools for validating specificity:

Domain Mapping

Expression of specific CptA domains helps identify functional regions:

  • N-terminal constructs (Nterm) have been shown to lack cytotoxic activity

  • Central region constructs retain hemolytic and cytotoxic functions

  • Structure-function correlations inform mechanism of action

  • Mutagenesis of specific residues can further define essential elements

Comparative Controls

  • Purification from expression systems containing empty vectors

  • Heat-inactivated protein preparations

  • Unrelated proteins purified using identical methods

  • Dose-response relationships demonstrating specific effects

These validation approaches collectively ensure that observed effects represent genuine CptA activity rather than experimental artifacts.

What are the future research directions for CptA studies?

Several promising research avenues warrant further investigation:

Genetic Manipulation

Development of genetic systems for manipulating S. amnii would enable:

Structural Biology

Detailed structural characterization would provide insights into:

  • Three-dimensional organization of functional domains

  • Membrane interaction interfaces

  • Oligomerization mechanisms

  • Rational design of inhibitors or neutralizing antibodies

Comparative Analysis

Broader examination across bacterial species could reveal:

  • Conservation of CptA-like proteins in diverse pathogens

  • Evolution of phosphoethanolamine transferase functions

  • Role in host-pathogen interactions across species

  • Potential as targets for broad-spectrum therapeutic approaches

These research directions highlight the continuing importance of CptA as a subject of scientific investigation with implications for understanding bacterial pathogenesis and developing novel antimicrobial strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.