Recombinant Escherichia coli Phosphoethanolamine transferase eptB (eptB)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics of eptB

eptB is a 574-amino acid inner membrane protein encoded by the yhjW (renamed eptB) gene in E. coli . Key features include:

PropertyDetailSource
Molecular Weight~62 kDa (predicted)
Transmembrane Segments5 predicted N-terminal segments
Catalytic ActivityTransfers phosphoethanolamine (PEtN) from phosphatidylethanolamine (PE) to lipid A
Cofactor RequirementCa²+ dependence for enzymatic function
Structural StabilityRequires membrane integration; recombinant versions retain activity

Functional Roles in Bacterial Physiology

eptB modifies the outer 3-deoxy-D-manno-octulosonic acid (Kdo) residue of lipopolysaccharide (LPS) or lipid A, enabling bacterial adaptation to stressors :

Lipid A Modification

eptB transfers PEtN to lipid A, neutralizing its negative charge. This reduces binding to cationic antimicrobial peptides (CAMPs) like colistin, enhancing resistance .

Modification SiteImpact on Bacterial ResistanceExperimental Evidence
Lipid A 1-phosphateElevated PEtN transfer under colistin stressqPCR shows 2–4× upregulation in mcr-1 isolates
Kdo residue (core LPS)Protection against Ca²+ toxicityeptB knockout strains are hypersensitive to Ca²+

Stress Response Regulation

eptB expression is induced by:

  • High Ca²+ concentrations (5–50 mM)

  • Subinhibitory colistin exposure in clinical isolates

  • PhoQP system (phosphate regulation)

Clinical Relevance in Antimicrobial Resistance

eptB contributes to colistin resistance in E. coli through LPS remodeling. Key findings include:

MechanismObservationClinical Implication
Lipid A PEtN additionReduces colistin binding to lipid A’s phosphate groups Reduces susceptibility to polymyxins
Synergy with mcr-1eptB expression increases in mcr-1-harboring isolates under colistin stressComplicates therapy in mcr-1-positive strains
Cross-Resistance PotentialPEtN modification may confer resistance to other CAMPs (e.g., polymyxin B)Broad-spectrum resistance risk

Recombinant Production and Applications

Recombinant eptB is produced in diverse systems for biochemical studies:

Host SystemPurityApplications
E. coli≥85% (SDS-PAGE)Enzymatic assays, structural studies
Yeast/Mammalian cellsVariableFunctional studies requiring post-translational modifications

Key Recombinant Forms :

  • Full-length eptB (1–563 aa)

  • Partial fragments (e.g., lipid A-binding domains)

  • Tag-free versions for native conformation studies

Research Gaps and Future Directions

  1. Structural Elucidation: High-resolution crystallography to map PEtN-binding sites.

  2. Inhibitor Development: Targeting eptB’s Ca²+-binding pocket or PEtN transfer mechanism.

  3. Diagnostic Biomarkers: Monitoring eptB expression in clinical isolates for resistance surveillance.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your preferred format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All protein orders are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply for this service.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
eptB; yhjW; b3546; JW5660; Kdo(2-lipid A phosphoethanolamine 7''-transferase; Phosphoethanolamine transferase EptB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-563
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
eptB
Target Protein Sequence
MRYIKSITQQKLSFLLAIYIGLFMNGAVFYRRFGSYAHDFTVWKGISAVVELAATVLVTF FLLRLLSLFGRRSWRILASLVVLFSAGASYYMTFLNVVIGYGIIASVMTTDIDLSKEVVG LNFILWLIAVSALPLILIWNNRCRYTLLRQLRTPGQRIRSLAVVVLAGIMVWAPIRLLDI QQKKVERATGVDLPSYGGVVANSYLPSNWLSALGLYAWARVDESSDNNSLLNPAKKFTYQ APQNVDDTYVVFIIGETTRWDHMGIFGYERNTTPKLAQEKNLAAFRGYSCDTATKLSLRC MFVRQGGAEDNPQRTLKEQNIFAVLKQLGFSSDLYAMQSEMWFYSNTMADNIAYREQIGA EPRNRGKPVDDMLLVDEMQQSLGRNPDGKHLIILHTKGSHFNYTQRYPRSFAQWKPECIG VDSGCTKAQMINSYDNSVTYVDHFISSVIDQVRDKKAIVFYAADHGESINEREHLHGTPR ELAPPEQFRVPMMVWMSDKYLENPANAQAFAQLKKEADMKVPRRHVELYDTIMGCLGYTS PDGGINENNNWCHIPQAKEAAAN
Uniprot No.

Target Background

Function
EptB catalyzes the addition of a phosphoethanolamine (pEtN) moiety to the outer 3-deoxy-D-manno-octulosonic acid (Kdo) residue of a Kdo(2)-lipid A. Phosphatidylethanolamines with one unsaturated acyl group serve as pEtN donors, and the reaction releases diacylglycerol.
Gene References Into Functions
  1. The active site of EptB faces the periplasmic surface of the inner membrane. PMID: 15795227
Database Links
Protein Families
Phosphoethanolamine transferase family, EptB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoethanolamine Transferase EptB?

EptB (formerly called YhjW) is an enzyme in Escherichia coli that catalyzes the transfer of phosphoethanolamine (PEtN) groups to specific molecules in the bacterial cell envelope. Specifically, EptB modifies the outer Kdo (3-deoxy-D-manno-octulosonic acid) residue of lipopolysaccharide (LPS) with phosphoethanolamine, using phosphatidylethanolamine as a precursor . This modification plays a significant role in bacterial resistance to antimicrobial peptides and antibiotics like colistin .

What is the structural classification of EptB?

EptB belongs to the YhjW/YjdB/YijP family, which is a subfamily of the larger alkaline phosphatase superfamily. Members of this superfamily share conserved core structures and active-site residues. Their enzymatic mechanisms are thought to involve catalytic cycles of phosphorylation, sulfatation, or phosphonation of conserved Ser/Cys/Thr residues, similar to the reaction scheme proposed for E. coli alkaline phosphatase .

What are the primary functions of EptB in E. coli?

The primary function of EptB is to modify the lipopolysaccharide (LPS) structure by adding phosphoethanolamine to the outer Kdo residue. This modification alters the net charge of the bacterial cell surface, reducing the binding affinity of cationic antimicrobial peptides and certain antibiotics like colistin . EptB encodes Ca2+-induced pEtN which modifies the outer Kdo residue of E. coli LPS, thus leading to colistin resistance .

How is the eptB gene regulated in E. coli?

The eptB gene in E. coli is regulated by various environmental and stress factors. Research suggests that its expression is influenced by calcium levels, as EptB is described as a Ca2+-induced phosphoethanolamine transferase . Additionally, exposure to subinhibitory concentrations of colistin can enhance the expression of eptB, particularly in strains harboring the mcr-1 gene . This suggests a complex regulatory network that responds to both environmental conditions and antibiotic pressure.

What genomic associations does eptB have with other genes?

Network analysis has shown that eptB is a highly interconnected node in colistin resistance gene networks. It is associated with 26 biological processes grouped into three major categories: lipopolysaccharide metabolic processes, intracellular signal transduction, and oligosaccharide biosynthetic processes . This high connectivity suggests that eptB plays a central role in coordinating cellular responses related to membrane modification and antibiotic resistance.

How can eptB be cloned and expressed in recombinant systems?

Methodologically, eptB can be cloned using techniques such as SOE PCR (Splicing by Overlap Extension) with appropriate primers to introduce restriction sites. For expression, the gene can be inserted into vectors like pMMB67EH or pJT19 under inducible promoters . Transformed E. coli strains can be grown to an OD660 of 0.8 and induced with 0.4 mM IPTG or 2 mM m-toluate for approximately 2 hours . Expression can be verified through SDS-PAGE analysis, immunoblotting, and mass spectrometry to confirm protein production and functionality.

What is the substrate specificity of EptB?

EptB specifically catalyzes the transfer of phosphoethanolamine groups to the outer Kdo residue of lipopolysaccharide in E. coli . It uses phosphatidylethanolamine as a donor substrate . Unlike some related enzymes that modify multiple positions in LPS, EptB appears to be relatively specific for the Kdo residue, which is crucial for its role in antimicrobial resistance and membrane modification.

How can the enzymatic activity of EptB be measured?

The enzymatic activity of EptB can be assessed through multiple approaches:

  • Mass spectrometry (MS)-based analysis of lipid A structures, particularly using negative- and positive-ion matrix-assisted laser desorption ionization–time of flight (MALDI-TOF) MS

  • Comparative analysis of LPS profiles from wild-type and eptB deletion mutants

  • Immunoblotting to detect mobility shifts in modified LPS components

  • Functional assays measuring resistance to cationic antimicrobial peptides as an indirect measure of EptB activity

What factors influence EptB activity in bacterial cells?

Several factors influence EptB activity in bacterial cells:

  • Calcium concentration - EptB is described as a Ca2+-induced enzyme

  • Presence of antibiotic pressure, particularly colistin

  • Expression levels of regulatory genes in the LPS modification pathway

  • Availability of the phosphatidylethanolamine substrate

  • Genetic background, including the presence of mcr genes that may enhance eptB expression

How does EptB contribute to colistin resistance in E. coli?

EptB contributes to colistin resistance by catalyzing the addition of phosphoethanolamine to the outer Kdo residue of LPS. This modification alters the net charge of the bacterial outer membrane, reducing the binding affinity of colistin, which is a cationic antimicrobial peptide . Research has demonstrated that the expression of eptB is enhanced in colistin-resistant clinical isolates, particularly when exposed to subinhibitory concentrations of colistin .

What is the relationship between eptB and mcr-1 in colistin resistance?

Studies have shown a significant interplay between chromosomally encoded eptB and the plasmid-mediated mcr-1 gene in colistin resistance. When exposed to subinhibitory concentrations of colistin, E. coli isolates harboring mcr-1 showed enhanced expression of eptB compared to isolates without mcr-1 . This suggests that mcr-1 may potentiate the expression or activity of eptB, creating a synergistic effect that enhances colistin resistance.

How can eptB expression be quantified in colistin-resistant strains?

The expression of eptB in colistin-resistant strains can be quantified using real-time PCR (qPCR). RNA is extracted from bacterial cultures, reverse transcribed to cDNA, and then amplified using eptB-specific primers with a reference housekeeping gene like rpsL for normalization . The threshold cycle (ΔΔCt) method can be employed to calculate fold-changes in eptB expression under different conditions, such as with or without colistin exposure .

Table 1: Relationship between eptB expression and colistin resistance factors in E. coli

FactorImpact on eptB expressionEffect on colistin resistanceStatistical significance
mcr-1 presenceEnhanced expressionIncreased resistancep < 0.05
Colistin exposureUpregulationEnhanced resistancep < 0.001
Ca2+ concentrationIncreased activityIncreased resistancep < 0.05
Genetic backgroundVariable expressionStrain-dependent resistanceVariable

What are the optimal conditions for expressing recombinant EptB?

For optimal expression of recombinant EptB:

  • Select appropriate E. coli expression strains (DH5α, S17.1)

  • Use vectors with inducible promoters (IPTG-inducible or m-toluate-inducible systems)

  • Grow cultures to mid-log phase (OD660 of 0.8)

  • Induce with 0.4 mM IPTG or 2 mM m-toluate for approximately 2 hours

  • Harvest cells by centrifugation at 4,000 × g for 20 minutes

  • Verify expression through SDS-PAGE, immunoblotting, or mass spectrometry

How can deletion mutants be created to study eptB function?

Creating eptB deletion mutants typically involves:

  • Designing primers that flank the eptB gene with appropriate restriction sites

  • Amplifying upstream and downstream regions of the gene

  • Introducing an antibiotic resistance cassette between these regions

  • Using homologous recombination to replace the wild-type gene with the deletion construct

  • Screening transformants for the correct deletion using PCR and sequencing

  • Verifying phenotypic changes through colistin susceptibility testing and LPS analysis

What approaches can be used to study the structure-function relationship of EptB?

Several approaches can be employed to study the structure-function relationship of EptB:

  • Site-directed mutagenesis of conserved residues

  • Domain swapping with related phosphoethanolamine transferases

  • Homology modeling based on related enzymes from the alkaline phosphatase superfamily

  • Expression of truncated versions to identify essential domains

  • Complementation studies in eptB deletion mutants

  • Biochemical assays to assess the impact of mutations on enzyme activity

How can transcriptomics be used to understand eptB regulation networks?

Transcriptomic approaches provide powerful tools for understanding the regulatory networks controlling eptB expression:

  • RNA-seq analysis comparing wild-type and regulatory mutant strains

  • Time-course experiments following exposure to different stressors (antibiotics, calcium concentration changes)

  • Analysis of differential expression patterns in colistin-resistant versus susceptible isolates

  • Correlation of eptB expression with other genes in the colistin resistance network

  • Integration of transcriptomic data with network analysis to identify key regulatory nodes

What is the impact of environmental factors on eptB expression and function?

Environmental factors significantly impact eptB expression and function:

  • Calcium concentration directly influences EptB activity as it is a Ca2+-induced enzyme

  • Antibiotic pressure, particularly subinhibitory concentrations of colistin, enhances eptB expression

  • Growth phase and medium composition may affect phosphatidylethanolamine availability

  • pH changes might impact enzyme activity or substrate binding

  • Host environment factors during infection could modulate expression patterns

How do heterologous expression systems compare for studying EptB function?

Different heterologous expression systems offer various advantages for studying EptB:

  • E. coli expression systems provide ease of genetic manipulation but may have different regulatory networks than the native context

  • P. aeruginosa expression systems have been used successfully for studying EptB function

  • Cell-free expression systems might allow for direct enzymatic analysis without cellular regulation

  • Expression in deletion mutants allows for complementation studies to confirm function

  • Expression with various fusion tags can facilitate purification and localization studies

What mass spectrometry techniques are most effective for analyzing EptB-modified LPS?

Mass spectrometry techniques that are particularly effective for analyzing EptB-modified LPS include:

  • Negative- and positive-ion matrix-assisted laser desorption ionization–time of flight (MALDI-TOF) MS for lipid A structure assessment

  • Electrospray ionization mass spectrometry (ESI-MS) for detailed structural characterization

  • Tandem mass spectrometry (MS/MS) for fragmentation analysis to identify specific modification sites

  • High-resolution MS for accurate mass determination of modified LPS components

  • Comparative MS profiling of wild-type versus eptB deletion mutants to identify specific changes

How can statistical analysis be applied to eptB expression data?

Statistical analysis of eptB expression data can be approached through:

  • Univariable and multivariable logistic regression models to investigate factors associated with expression levels

  • Calculation of odds ratios (OR) with 95% confidence intervals to quantify relationships

  • Student's t-test or ANOVA for comparing expression levels between different strains or conditions

  • Pearson's chi-squared test or Fisher's exact test for categorical variable analysis

  • Multivariate adjusted models including relevant clinical and demographic characteristics

Table 2: Statistical approaches for analyzing eptB expression data

Statistical MethodApplicationAdvantagesLimitations
Univariate analysisInitial assessment of factors influencing eptB expressionSimple to perform and interpretDoes not account for confounding variables
Multivariate analysisAdjusted assessment of factorsControls for confounding variablesRequires larger sample sizes
Student's t-testComparison between two groupsStraightforward for simple comparisonsLimited to two groups only
ANOVAComparison among multiple groupsCan analyze complex experimental designsAssumes normal distribution
Pearson's chi-squaredAnalysis of categorical dataAppropriate for frequency dataRequires adequate sample sizes

What are the challenges in purifying active recombinant EptB?

Purifying active recombinant EptB presents several challenges:

  • Membrane association may require detergent solubilization

  • Maintaining the correct folding and conformation during purification

  • Preserving calcium binding capability essential for activity

  • Preventing aggregation or precipitation during concentration steps

  • Developing activity assays suitable for purified enzyme rather than whole-cell systems

  • Stability issues during storage and experimental procedures

How does EptB differ from other phosphoethanolamine transferases like EptA?

EptB and EptA both function as phosphoethanolamine transferases in E. coli but differ in their specificity and cellular roles:

  • Substrate specificity: EptB primarily modifies the outer Kdo residue of LPS , while EptA targets the 1-phosphate group of lipid A

  • Regulation: They appear to be regulated by different environmental signals, with EptB being calcium-induced

  • Contribution to resistance: Both contribute to colistin resistance, but through modifications at different sites of the LPS molecule

  • Genetic context: They may be found in different genetic contexts, with eptB being highly interconnected in resistance gene networks

What homologs of EptB exist across different bacterial species?

EptB belongs to a family of phosphoethanolamine transferases found across many Gram-negative bacteria. Related enzymes include:

  • CptA and PmrC from Salmonella enterica

  • LptA from various Gram-negative bacteria

  • Lpt3 and Lpt6 from Neisseria meningitidis

  • PptA from Neisseria gonorrhoeae, involved in pilin modification

These homologs share structural features and belong to the YhjW/YjdB/YijP family, a subfamily of the alkaline phosphatase superfamily .

What are the promising future research directions for EptB studies?

Several promising research directions for EptB studies include:

  • Development of specific inhibitors targeting EptB to restore colistin sensitivity

  • Structural determination through X-ray crystallography or cryo-EM

  • Investigation of the interplay between different LPS modification systems in antimicrobial resistance

  • Exploration of EptB's potential role in bacterial virulence beyond antibiotic resistance

  • Examination of eptB expression patterns during host infection using in vivo models

  • Application of CRISPR-Cas systems for precise genetic manipulation of eptB in clinical isolates

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.