Recombinant Escherichia coli Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview

Phosphoglycerol Transferase I (EC 2.7.8.20), encoded by the mdoB gene in E. coli, catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol (PG) to membrane-derived oligosaccharides or synthetic substrates like arbutin. This reaction produces sn-1,2-diglyceride and phosphoglycerol-modified MDOs, which are essential for bacterial osmoregulation and periplasmic homeostasis .

Key Biochemical Properties

PropertyDetail
SubstratePhosphatidylglycerol (donor); MDOs or arbutin (acceptor)
Reaction Productssn-1,2-diglyceride + phosphoglycerol-substituted MDOs/arbutin
LocalizationInner cytoplasmic membrane (periplasmic-facing active site)
CofactorsNone required
pH OptimumNot explicitly reported; inferred neutral (based on in vivo assays)

Genetic Mapping

  • The mdoB locus maps near minute 99 on the E. coli chromosome, closely linked to serB and thr genes .

  • Mutants lacking mdoB (e.g., mdoB::Tn10) fail to transfer phosphoglycerol residues to MDOs or arbutin, confirming its essential role in MDO glycerophosphorylation .

Functional Studies

  • In vitro activity: Purified MdoB transfers phosphoglycerol from PG to MDOs or arbutin, producing diglycerides .

  • In vivo role: MDOs in mdoB mutants lack phosphoglycerol substitutions, impairing osmoregulatory function .

  • Cross-talk with other enzymes: Phosphoglycerol Transferase II (soluble periplasmic enzyme) redistributes phosphoglycerol residues among MDOs but cannot substitute for MdoB’s primary transfer activity .

Recombinant Production

Recombinant MdoB is produced in yeast expression systems, enabling biochemical and structural studies .

Mechanistic Studies

  • Substrate specificity: Arbutin serves as a model substrate to assay MdoB activity in vivo and in vitro .

  • Enzyme kinetics: Assays using radiolabeled PG or arbutin quantify transfer efficiency .

Physiological Relevance

  • Osmoregulation: MDOs modified by MdoB help E. coli adapt to osmotic stress .

  • Genetic interactions: mdoB mutants exhibit no cross-activation of the Rcs phosphorelay system, ruling out MDO defects as a trigger for Rcs signaling .

Key Mutant Phenotypes

MutationPhenotypeReference
mdoB::Tn10No phosphoglycerol transfer to MDOs/arbutin
dgk-6 + mdoBArbutin resistance; growth inhibition rescue

Future Directions

  • Structural analysis: No high-resolution structures of MdoB exist; recombinant protein production enables crystallography or cryo-EM studies .

  • Biotechnological applications: Engineered MdoB variants could optimize bacterial osmoregulation in industrial fermentation.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them when placing your order, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during the production process. If you have a specific tag type preference, kindly communicate it to us, and we will prioritize developing the specified tag.
Synonyms
mdoB; opgB; ECSE_4635; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Escherichia coli (strain SE11)
Target Names
mdoB
Target Protein Sequence
MSELLSFALFLASVLIYAWKAGRNTWWFAATLTVLGLFVVLNITLFASDYFTGDGINDAV LYTLTNSLTGAGVSKYILPGIGIVLGLTAVFGALGWILRRRRHHPHHFGYSLLALLLALG SVDASPAFRQITELVKSQSRDGDPDFAAYYKEPSKTIPDPKLNLVYIYGESLERTYFDNE AFPDLTPELGALKNEGLDFSHTQQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGSEELKSVVADPHYRND WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKKYDFDGKPNQS FSAVSCSQENIAAFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVIRG DKPQQETLAVKRNTMDNGATVLDILGGDNYLGLGRSSLSGQSMSEIFLNIKEKTLAWKPD IIRLWKFPKEMKEFTIDQQKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQIVQHVDKTMWKGKTAFKD TVIDMARYKSNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKHPLPKKFDLVITAKAYGNNASRPIPVRVGNEEQTLVLGNEVTTTTLHFDNP TDADTLVIVPPEPVSTNEGNILGHSPRKLGIGMVEIKVVEREG
Uniprot No.

Target Background

Function
This protein facilitates the transfer of a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoglycerol Transferase I (mdoB) and what is its primary function in Escherichia coli?

Phosphoglycerol transferase I (mdoB) is an enzyme located in the inner cytoplasmic membrane of Escherichia coli that catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDO) or to model substrates such as arbutin (p-hydroxyphenyl-beta-D-glucoside) . The products of this enzymatic reaction are phosphoglycerol diester derivatives of MDO (or arbutin) and sn-1,2-diglyceride . The enzyme plays a crucial role in membrane biology as it contributes to the modification of periplasmic oligosaccharides, which may affect membrane properties and cellular responses to environmental conditions.

The enzyme has its active site on the outer aspect (periplasmic side) of the inner membrane, which enables it to catalyze the transfer of phosphoglycerol residues to arbutin when added to the growth medium . This distinctive topological arrangement makes it an interesting target for studying membrane protein function and periplasmic biochemistry.

How is the mdoB gene organized in the Escherichia coli genome?

The mdoB gene is located near minute 99 on the E. coli genetic map, approximately around the 4680 kb position . Genetic mapping studies using phage P1 transduction have determined that mdoB::TnlO mutation is 56% cotransducible with serB and 36% cotransducible with thr . Three-factor crosses have confirmed the gene order to be mdoB-serB-thr .

Fine mapping of the mdoB locus was achieved using clones from the Kohara library (specifically clones 8D1 and 5C1) . Subsequent subcloning and analysis revealed that the mdoB gene is located immediately adjacent to the dnaTC region, with physical mapping placing it between the tsr and dnaTC genes on the E. coli chromosome . This precise genomic location is critical for researchers conducting genetic manipulation or complementation studies with mdoB.

What are the optimal conditions for purifying recombinant mdoB protein while maintaining enzyme activity?

Purification of recombinant phosphoglycerol transferase I (mdoB) requires careful consideration of its membrane protein nature. Based on available data for recombinant full-length His-tagged enzyme, the following purification guidelines are recommended:

Purification ParameterRecommended ConditionRationale
Initial extractionMild detergentsPreserves protein folding and activity
Affinity chromatographyNi-NTA for His-tagged versionsAllows specific binding and elution
Buffer compositionTris/PBS-based buffer, pH 8.0Maintains stability during purification
Stabilizing agents6% TrehalosePrevents aggregation and activity loss
Storage formLyophilized powderIncreases long-term stability
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Controls concentration and purity
Storage additives5-50% glycerol (final concentration)Prevents freeze-damage
Storage temperature-20°C/-80°CMinimizes degradation

For activity assays during purification, researchers should avoid repeated freeze-thaw cycles as they can significantly reduce enzyme activity . Working aliquots should be stored at 4°C for no more than one week to maintain optimal activity .

Purity assessment by SDS-PAGE typically shows greater than 90% purity for properly purified recombinant mdoB protein . Western blotting using anti-His antibodies can confirm the identity of the purified protein.

What methods are available for measuring Phosphoglycerol Transferase I activity in vitro?

Several methodological approaches can be employed to measure phosphoglycerol transferase I activity in vitro:

  • Arbutin-based assay: This assay utilizes arbutin (p-hydroxyphenyl-beta-D-glucoside) as a model substrate . The enzyme catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to arbutin, producing a phosphoglycerol diester derivative of arbutin and sn-1,2-diglyceride . Detection of either product can be used to quantify enzyme activity.

  • Direct MDO modification assay: This more physiologically relevant assay measures the transfer of phosphoglycerol residues to membrane-derived oligosaccharides . Radiolabeled phosphatidylglycerol can be used as the phosphoglycerol donor, with subsequent detection of labeled MDO products.

  • Diglyceride formation measurement: Since sn-1,2-diglyceride is a product of the phosphoglycerol transferase I reaction, measuring its accumulation provides an indirect measure of enzyme activity . This is particularly relevant in strains bearing the dgk mutation (defective in diglyceride kinase) which accumulate diglyceride.

For standardized activity measurements, reaction conditions should include:

  • Appropriate membrane fractions or purified enzyme

  • Phosphatidylglycerol substrate (typically in micellar or vesicular form)

  • Acceptor substrate (MDO or arbutin)

  • Buffer conditions that maintain enzyme stability (typically pH 7.0-8.0)

  • Divalent cations if needed for stability (not directly involved in catalysis)

How can researchers distinguish between endogenous and recombinant mdoB activity in experimental systems?

Distinguishing between endogenous and recombinant phosphoglycerol transferase I activity is critical for accurate experimental interpretation. Several strategies can be employed:

  • Genetic approaches:

    • Use mdoB knockout strains as expression hosts to eliminate background activity

    • Introduce mutations in recombinant mdoB that create distinguishable enzymatic properties

    • Utilize mdoB::TnlO mutant strains that have been well-characterized genetically

  • Biochemical approaches:

    • Express recombinant mdoB with affinity tags that allow separate purification and assay

    • Use epitope-tagged versions that can be immunoprecipitated or immunodetected

    • Employ size-based separation if recombinant protein has significantly different molecular weight

  • Activity-based approaches:

    • Conduct arbutin resistance assays in dgk mutant strains, where presence of phosphoglycerol transferase I activity causes growth inhibition in arbutin-containing media

    • Analyze phosphoglycerol content of MDO, as mdoB mutants produce MDO devoid of phosphoglycerol residues

    • Measure in vivo transfer of phosphoglycerol residues to exogenously added arbutin, which is specific to functional mdoB activity

A combination of these approaches provides the most robust discrimination between endogenous and recombinant activity. Researchers should include appropriate controls in each experiment, such as comparing activity in the presence and absence of inducer for inducible expression systems.

What genetic approaches have been most successful for studying mdoB function in Escherichia coli?

Several genetic approaches have proven effective for studying mdoB function in E. coli:

  • Transposon mutagenesis: The use of TnlO transposon insertions has been effective in generating mdoB mutants . These mdoB::TnlO mutations have been particularly useful for genetic mapping and functional studies of phosphoglycerol transferase I.

  • Phage P1 transduction: This technique has been instrumental in determining genetic linkage relationships between mdoB and other genes. Studies have shown mdoB::TnlO mutation to be 56% cotransducible with serB and 36% cotransducible with thr , providing important mapping information.

  • Three-factor crosses: This classical genetic approach confirmed the gene order mdoB-serB-thr , further refining the genetic map location of mdoB.

  • Selection strategies: Researchers have exploited the relationship between arbutin resistance and phosphoglycerol transferase I activity to select for mdoB mutants. In strains defective in diglyceride kinase (dgk mutation), growth in arbutin-containing media leads to accumulation of diglyceride and growth inhibition. Secondary mutations in mdoB confer arbutin resistance, providing a powerful selection strategy .

  • Complementation analysis: By introducing cloned mdoB genes into mdoB mutants, researchers can determine if gene function is restored. This approach has been used with various fragments from lambda phage clones (e.g., clones 8D1 and 5C1 from the Kohara library) to fine map and characterize the mdoB locus.

Each of these approaches provides different insights into mdoB function, and combining multiple methods yields the most comprehensive understanding of this enzyme's role in bacterial physiology.

How do mutations in mdoB affect membrane-derived oligosaccharide composition and bacterial physiology?

Mutations in the mdoB gene have significant effects on membrane-derived oligosaccharide (MDO) composition and potentially on bacterial physiology:

  • Effects on MDO composition:

    • mdoB mutants synthesize MDO completely devoid of phosphoglycerol residues

    • The absence of phosphoglycerol modification does not prevent the formation of the basic oligosaccharide structure

    • Other MDO modifications (such as succinic acid O-ester and phosphoethanolamine) may still occur in mdoB mutants

  • Physiological consequences:

    • Changes in MDO composition may alter periplasmic osmolarity regulation

    • Modified surface properties could affect interactions with the environment

    • Membrane characteristics might be altered due to changes in phospholipid metabolism resulting from decreased phosphatidylglycerol turnover

  • Specific phenotypes:

    • mdoB mutants show resistance to arbutin when combined with dgk mutations

    • The loss of phosphoglycerol transferase I activity prevents the accumulation of diglyceride that occurs in dgk mutants grown in arbutin-containing media

    • This resistance phenotype has been exploited to isolate and characterize mdoB mutations

These findings provide strong genetic evidence for the specific role of phosphoglycerol transferase I in MDO biosynthesis and modification. The precise physiological importance of phosphoglycerol-modified MDO remains an area of active investigation, with implications for membrane biology, stress responses, and potentially pathogen-host interactions.

How can structural biology approaches enhance our understanding of phosphoglycerol transferase I mechanism?

Structural biology approaches offer powerful tools for elucidating the mechanistic details of phosphoglycerol transferase I function. While detailed structural data for phosphoglycerol transferase I is limited in the provided search results, researchers can apply several structural biology techniques:

  • X-ray crystallography: Determining the three-dimensional structure of purified recombinant mdoB protein would reveal:

    • The spatial arrangement of the active site

    • Substrate binding pockets for both phosphatidylglycerol and membrane-derived oligosaccharides

    • Potential conformational changes during catalysis

    • Membrane association domains

  • Cryo-electron microscopy (cryo-EM): This approach might be particularly valuable for:

    • Visualizing mdoB in its native membrane environment

    • Capturing different conformational states during the catalytic cycle

    • Understanding oligomeric arrangements if the protein functions as a multimer

  • Site-directed mutagenesis coupled with activity assays: Based on the detailed 763-amino acid sequence available for phosphoglycerol transferase I , researchers can:

    • Identify and mutate potential catalytic residues

    • Probe membrane interaction domains

    • Investigate substrate specificity determinants

  • Molecular dynamics simulations: Using computational approaches to:

    • Model substrate binding and product release

    • Examine protein-membrane interactions

    • Predict conformational changes during catalysis

These structural approaches would significantly advance our understanding of how phosphoglycerol transferase I catalyzes the transfer of phosphoglycerol moieties and could potentially inform the development of specific inhibitors or biotechnological applications of this enzyme.

What is known about the evolutionary conservation of phosphoglycerol transferase I across bacterial species?

The evolutionary conservation of phosphoglycerol transferase I across bacterial species represents an important area for comparative genomics research. While the search results do not provide comprehensive information about evolutionary conservation, several aspects can be examined:

  • Sequence homology analysis: Researchers can use the full-length E. coli mdoB sequence (763 amino acids) to:

    • Identify homologs in other bacterial species through BLAST searches

    • Perform multiple sequence alignments to identify conserved domains

    • Generate phylogenetic trees to understand evolutionary relationships

  • Functional conservation: Studies can investigate whether:

    • Homologs in other bacteria perform similar biochemical functions

    • There are species-specific adaptations in substrate specificity

    • The genomic context (neighboring genes) is conserved across species

  • Structural conservation: Analysis of predicted protein structural elements can reveal:

    • Conservation of membrane-spanning domains

    • Preservation of catalytic residues

    • Maintenance of substrate binding pockets

  • Taxonomic distribution: Examining the presence or absence of mdoB homologs across:

    • Different bacterial phyla

    • Pathogenic versus non-pathogenic species

    • Species with different membrane compositions

Understanding the evolutionary conservation of phosphoglycerol transferase I would provide insights into the importance of this enzyme and its substrate modifications across bacterial species. This knowledge could help identify whether the enzyme represents a broadly conserved aspect of bacterial membrane biology or a specialized adaptation in certain lineages.

What are common challenges in expressing and purifying active recombinant phosphoglycerol transferase I?

Researchers working with recombinant phosphoglycerol transferase I frequently encounter several challenges:

  • Membrane protein expression issues:

    • Low expression levels due to toxicity or improper folding

    • Formation of inclusion bodies

    • Challenges in solubilization without denaturing the protein

    • Proper membrane targeting during expression

  • Purification challenges:

    • Selection of appropriate detergents that maintain activity

    • Protein aggregation during concentration steps

    • Loss of activity during purification procedures

    • Removal of contaminating E. coli phospholipids that may interfere with activity assays

  • Stability considerations:

    • Repeated freeze-thaw cycles significantly reduce enzyme activity

    • Working aliquots should be stored at 4°C for no more than one week

    • Long-term storage requires lyophilization or glycerol addition (5-50% final concentration)

    • Reconstitution buffer composition affects stability and activity

  • Activity measurement difficulties:

    • Establishing reliable in vitro assay conditions

    • Providing phosphatidylglycerol substrate in an accessible form

    • Distinguishing recombinant activity from any endogenous activity

    • Quantifying products accurately

To address these challenges, researchers should consider:

  • Using Tris/PBS-based buffers with 6% trehalose at pH 8.0 for storage

  • Reconstituting lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Adding glycerol (5-50%) for aliquots intended for freezing

  • Storing working aliquots at 4°C and long-term stocks at -20°C/-80°C

How can researchers optimize in vivo assays for phosphoglycerol transferase I activity?

Optimizing in vivo assays for phosphoglycerol transferase I activity requires careful experimental design:

  • Arbutin-based assays:

    • This approach leverages the enzyme's ability to transfer phosphoglycerol residues to arbutin added to the growth medium

    • Optimization considerations include:

      • Arbutin concentration (typically 0.1-0.5%)

      • Growth media composition

      • Cell density and growth phase

      • Incubation time

  • Growth inhibition assays in dgk backgrounds:

    • In diglyceride kinase (dgk) mutants, phosphoglycerol transferase I activity with arbutin leads to diglyceride accumulation and growth inhibition

    • Key parameters to optimize:

      • Strain construction (dgk mutation combined with wild-type or mutant mdoB)

      • Arbutin concentration titration

      • Growth curve analysis

      • Media composition

  • MDO phosphoglycerol content analysis:

    • Direct measurement of phosphoglycerol modification of MDO

    • Optimization factors include:

      • Extraction methods for MDO

      • Analytical techniques (chromatography, mass spectrometry)

      • Growth conditions that maximize MDO production

      • Internal standards for quantification

  • Genetic complementation approaches:

    • Introduction of recombinant mdoB into mdoB-deficient strains

    • Variables to optimize:

      • Expression vector selection

      • Induction conditions

      • Phenotypic assays to measure restoration of function

      • Controls to verify expression levels

When designing these assays, researchers should include appropriate controls:

  • Wild-type E. coli strains (positive control for phosphoglycerol transferase I activity)

  • mdoB mutant strains (negative control)

  • Complemented strains (to verify that observed phenotypes are due to mdoB)

  • Media controls without arbutin (baseline for growth comparisons)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.