Recombinant Escherichia coli Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Description

Introduction

The Kdp complex, a high-affinity ATP-driven K(+) transport system in Escherichia coli, comprises four membrane-bound subunits: KdpF, KdpA, KdpB, and KdpC . While the roles of KdpB (catalytic subunit), KdpA (K(+)-translocating subunit), and KdpF (stabilizing peptide) are relatively well-understood, the function of KdpC remains less clear . The KdpC subunit of the Escherichia coli K+-transporting KdpB P-type ATPase acts as a catalytic chaperone .

Structure and Function

KdpC is a subunit of the KdpFABC complex, which functions as a K+ transporter, merging ion pumps with ion channels . KdpC interacts strongly with the KdpA subunit and helps to assemble and stabilize the complex .

Research Findings

  • Complementation Studies Studies using truncated versions of the kdpC gene have revealed that only a derivative lacking base pairs coding for the four C-terminal amino acids can complement a chromosomal deletion of kdpC . Complementation was also observed with kdpC from Mycobacterium tuberculosis, but not with kdpC from Clostridium acetobutylicum or Synechocystis sp. PCC6803 .

  • Hybrid Construction Sequence alignment of 17 different KdpC proteins led to the creation of hybrids between kdpC of E. coli and that of C. acetobutylicum . Complementation experiments showed that the N-terminal transmembrane segment and the C-terminal-third of the protein could be exchanged between both species, but only one after the other; simultaneous substitution of both regions was not possible .

  • Interaction with KdpB The KdpC subunit interacts with the nucleotide-binding loop of KdpB in an ATP-dependent manner around the ATP-binding pocket .

  • Role as a Catalytic Chaperone KdpC functions as a catalytic chaperone .

Recombinant Production

Recombinant E. coli strains are frequently employed for the production of recombinant proteins . E. coli BL21 (DE3) strains offer advantages over E. coli K12, including lower acetate yield and higher biomass yield, which enhance protein production .

Applications

Understanding the function of KdpC improves the understanding of biological mechanisms and disease development and facilitates drug development .

Table: KdpC Protein Sequence Alignments

ProteinSequence Fragment
36_pfamImportnssENLSMLTVETFLNysiSHNEKQDFPLFGSYYVNTVALNF
P57688niTNLSVSDLYSYLYnlvNSTKTQNFPFFGSYYVNVVRLNV
Q5NEA6NNLSLEQVTKLIQANTKRHVFNVDTVNVLNLNIG

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
kdpC; b0696; JW0684; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
kdpC
Target Protein Sequence
MSGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIREGDTVRGSALIGQNFT GNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAALRAANPDASASVPVEL VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE LNLALDKLDE
Uniprot No.

Target Background

Function
The Escherichia coli KdpC protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC acts as a catalytic chaperone, enhancing the ATP-binding affinity of the ATPase subunit KdpB by forming a transient KdpB/KdpC/ATP ternary complex.
Gene References Into Functions
  1. High-affinity ATP binding to KdpFABC relies on conserved Gln residues within KdpC. ATP binding to KdpC and ATP hydrolysis by KdpFABC are sensitive to ribose hydroxyl accessibility. KdpC interacts with the KdpB ATP-binding loop. PMID: 21711450
  2. ATP binding occurs within the Val144-Lys161 peptide in the C-terminal region of KdpC. PMID: 16953591
  3. In the K+-translocating KdpFABC complex, KdpC functions as a catalytic chaperone, cooperatively interacting with the nucleotide undergoing hydrolysis. PMID: 18058005
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function of KdpC in the KdpFABC complex?

KdpC serves as a catalytic chaperone in the KdpFABC complex, playing a crucial role in ATP binding and hydrolysis. Unlike typical P-type ATPases, the KdpFABC complex employs a unique nucleotide-binding mechanism where KdpC interacts with the nucleotide-binding loop of KdpB in an ATP-dependent manner. This interaction occurs around the ATP-binding pocket, enhancing ATP-binding affinity through the formation of a transient KdpB/KdpC/ATP ternary complex . The mechanism bears more similarities to those found in ABC transporters rather than other P-type ATPases, representing a chimera of ion pumps and ion channels . The high-affinity potassium uptake mediated by this ATP-driven complex is essential for bacterial survival under potassium-limited conditions.

What structural features of KdpC are essential for its function?

KdpC contains an N-terminal transmembrane segment and a cytoplasmic domain with several key structural features essential for its function . A critical element is the conserved glutamine residue that is vital for high-affinity nucleotide binding, similar to the glutamine in the LSGGQ signature motif of ABC transporters . This glutamine residue likely forms double hydrogen bonds with the ATP nucleotide. The C-terminal region shows interesting properties, as truncation experiments reveal that the four C-terminal amino acids are dispensable for function, with mutations lacking these residues still able to complement a kdpC deletion . Additionally, both ATP binding to KdpC and ATP hydrolysis activity of KdpFABC are sensitive to the accessibility, presence, or absence of hydroxyl groups at the ribose moiety of the nucleotide . These structural features collectively contribute to KdpC's role as a regulatory component in the ATP-binding and hydrolysis processes of the complex.

How evolutionarily conserved is KdpC across bacterial species?

KdpC shows variable conservation across different bacterial groups, with interesting functional implications . Sequence alignment of 17 different KdpC proteins reveals conserved regions, particularly around functional domains such as the nucleotide-binding site. Complementation experiments demonstrate that KdpC from Mycobacterium tuberculosis can functionally replace E. coli KdpC, whereas KdpC from Clostridium acetobutylicum or Synechocystis sp. PCC6803 cannot . This suggests functional conservation despite sequence divergence in some species but not others. Hybrid protein studies indicate that certain regions, such as the N-terminal transmembrane segment and the C-terminal third of the protein, can be exchanged between species individually, but simultaneous substitution of both regions is not functional . This pattern suggests co-evolution of KdpC's central region with other parts of the Kdp complex, highlighting the importance of species-specific protein-protein interactions in maintaining functional integrity.

How does KdpC enhance ATP binding and hydrolysis in the KdpFABC complex?

KdpC employs several sophisticated mechanisms to enhance ATP binding and hydrolysis in the KdpFABC complex:

First, KdpC forms a transient KdpB/KdpC/ATP ternary complex that significantly increases ATP-binding affinity . This complex formation involves the conserved glutamine residue in KdpC, which likely forms hydrogen bonds with ATP similar to the LSGGQ motif in ABC transporters . High-affinity nucleotide binding to the KdpFABC complex depends critically on this conserved glutamine residue.

Second, KdpC interacts specifically with the nucleotide-binding loop of KdpB in an ATP-dependent manner around the ATP-binding pocket . This interaction likely stabilizes the binding pocket in a conformation favorable for ATP binding and subsequent hydrolysis.

Third, both ATP binding to KdpC and ATP hydrolysis activity of KdpFABC show sensitivity to the accessibility, presence, or absence of hydroxyl groups at the ribose moiety of the nucleotide . This suggests that KdpC makes specific contacts with the ribose portion of ATP, contributing to nucleotide recognition and orientation in the binding pocket.

Collectively, these mechanisms establish KdpC as a catalytic chaperone that employs a nucleotide-binding mechanism distinct from classical P-type ATPases, representing an evolutionary adaptation that optimizes the efficiency of potassium transport under limiting conditions.

What are the most effective experimental approaches for studying KdpC-KdpB interactions?

When investigating KdpC-KdpB interactions, researchers should consider these methodological approaches to ensure robust and reproducible results:

  • Co-immunoprecipitation with ATP analogs: Using non-hydrolyzable ATP analogs (AMP-PNP, ATP-γ-S) can stabilize the transient KdpB/KdpC/ATP ternary complex for isolation. Include multiple controls (no ATP, ADP instead of ATP) to confirm specificity.

  • Surface plasmon resonance (SPR): This technique allows real-time measurement of binding kinetics between purified KdpC and KdpB subunits under various nucleotide conditions. SPR can determine association and dissociation rates as well as equilibrium binding constants.

  • Crosslinking studies coupled with mass spectrometry: Chemical crosslinking can identify amino acid residues in close proximity between KdpC and KdpB, particularly around the ATP-binding pocket . Comparing crosslinking patterns with and without ATP can reveal conformational changes during nucleotide binding.

  • Fluorescence resonance energy transfer (FRET): Tagging KdpC and KdpB with fluorescent proteins can monitor their interaction in real-time and under different conditions, providing spatial information about the interaction.

  • Isothermal titration calorimetry (ITC): This technique measures the thermodynamic parameters of binding directly, revealing how ATP affects the energetics of KdpC-KdpB interaction.

For all these approaches, proper experimental design requires controlling for buffer composition, temperature, pH, and salt concentration, which can significantly influence protein-protein interactions. Additionally, researchers should perform multiple technical and biological replicates to ensure reproducibility, following the principles of unbiased experimental design3.

How should researchers design mutagenesis studies to investigate KdpC functional domains?

When designing mutagenesis studies to investigate KdpC functional domains, researchers should implement a systematic approach that considers both structure-function relationships and evolutionary conservation:

  • Target the conserved glutamine residue critical for nucleotide binding first, as high-affinity nucleotide binding to the KdpFABC complex depends on this residue . Create both conservative and non-conservative substitutions to assess the specific chemical requirements of this position.

  • Design truncation mutations based on previous findings that the four C-terminal amino acids are dispensable for function . Create a series of progressive truncations from both termini to map essential regions precisely.

  • Implement domain swapping experiments between KdpC from different species. Since KdpC from M. tuberculosis can complement E. coli KdpC deletion while C. acetobutylicum and Synechocystis versions cannot, create chimeric constructs to identify functionally compatible regions .

  • Use alanine scanning mutagenesis across regions predicted to interact with KdpB or ATP, systematically replacing charged or hydrophobic residues to identify amino acids involved in these interactions.

  • Introduce cysteine substitutions at strategic positions for subsequent crosslinking or labeling experiments to probe structural dynamics during ATP binding.

After creating these mutants, assess their functionality through complementation assays in a kdpC deletion strain and biochemical assays measuring ATP binding and hydrolysis. Throughout the experimental process, maintain rigorous controls and use a systematic approach to differentiate between direct effects on KdpC function versus indirect effects on protein stability or complex formation .

How can researchers analyze contradictory data regarding KdpC function?

When facing contradictory data regarding KdpC function, researchers should employ a systematic analytical framework to resolve discrepancies:

  • Examine methodological differences: Carefully analyze differences in experimental protocols including buffer composition, temperature, pH, protein preparation methods, and assay systems. Small variations in experimental conditions can significantly impact membrane protein function3.

  • Consider genetic background effects: Different E. coli strains used in various studies may contain genetic polymorphisms that influence KdpC function. Verify whether studies used the same parental strain for deletion and complementation experiments .

  • Assess protein quality: Contradictory functional data may stem from differences in protein folding, stability, or post-translational modifications. Compare purification methods and verify protein integrity through multiple techniques (SDS-PAGE, circular dichroism, size-exclusion chromatography).

  • Apply statistical rigor: Ensure that contradictions are statistically significant by applying appropriate statistical tests. Consider sample sizes, data variability, and potential outliers3.

  • Implement meta-analysis approaches: Systematically compare methodologies and results across multiple studies to identify patterns and potential sources of discrepancies.

  • Design definitive experiments: Create experiments specifically designed to address the contradictions, incorporating controls that can distinguish between alternative hypotheses. Use multiple complementary techniques to analyze the same phenomenon .

  • Consider complex formation context: Since KdpC functions as part of the KdpFABC complex, contradictory results might arise from studying KdpC in isolation versus within the intact complex .

What are the optimal methods for expressing and purifying recombinant KdpC?

For optimal expression and purification of recombinant KdpC, researchers should implement this comprehensive methodological approach:

Expression System Selection:

  • Use E. coli BL21(DE3) or C41(DE3) strains specifically designed for membrane protein expression

  • Consider the LEMO21(DE3) strain for tight control of expression level

  • For challenging constructs, explore cell-free expression systems

Vector Design:

  • Include an N-terminal His6 tag with a TEV protease cleavage site

  • Maintain the native signal sequence for proper membrane insertion

  • Consider codon optimization, particularly for rare codons in E. coli

  • Include the kdpC gene with its native ribosome binding site

Expression Conditions:

  • Induce at low temperatures (16-18°C) to facilitate proper folding

  • Use reduced IPTG concentration (0.1-0.3 mM) to prevent inclusion body formation

  • Extend expression time to 16-20 hours

  • Supplement media with 1% glucose to reduce basal expression

Membrane Extraction:

  • Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or LMNG for solubilization

  • Include glycerol (10%) in extraction buffers to stabilize the protein

  • Maintain physiological pH (7.4-7.8) throughout extraction

  • Add protease inhibitors to prevent degradation

Purification Strategy:

  • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Follow with size-exclusion chromatography to remove aggregates

  • Optional: ion exchange chromatography for higher purity

  • Consider lipid nanodisc reconstitution for functional studies

Quality Control:

  • Verify purity by SDS-PAGE and Western blotting

  • Confirm proper folding by circular dichroism

  • Assess oligomeric state by analytical ultracentrifugation

  • Validate functionality through ATP binding assays

This methodological approach should yield pure, properly folded KdpC suitable for structural and functional studies, while minimizing common pitfalls in membrane protein preparation.

What techniques are most effective for measuring ATP binding to KdpC?

For measuring ATP binding to KdpC, researchers should consider these complementary methodological approaches, each offering distinct advantages:

Fluorescence-Based Methods:

  • Fluorescent ATP analogs (TNP-ATP, MANT-ATP)

    • Provide direct measurement of binding through increased fluorescence

    • Can be used with purified KdpC or KdpFABC complex

    • Allow determination of binding affinity (Kd) and kinetics

    • Can detect changes in binding due to mutations in the conserved glutamine residue

  • Intrinsic tryptophan fluorescence

    • Monitors conformational changes upon ATP binding

    • Non-destructive and requires no ATP modification

    • Can be used to study binding kinetics in real-time

Equilibrium Binding Assays:

  • Isothermal Titration Calorimetry (ITC)

    • Provides complete thermodynamic profile (ΔH, ΔS, ΔG)

    • Determines binding stoichiometry

    • Requires no modification of ATP or protein

    • Can distinguish between binding models (single site, cooperative)

  • Microscale Thermophoresis (MST)

    • Requires minimal protein amounts

    • Works in solution with various detergents

    • Can measure affinities from pM to mM range

    • Particularly useful for membrane proteins

Filter Binding Assays:

  • Radioactive [γ-32P]ATP or [α-32P]ATP

    • High sensitivity allows detection of low-affinity interactions

    • Can measure binding to KdpC when incorporated in the full KdpFABC complex

    • Particularly useful for comparing wild-type and mutant proteins

    • Requires careful controls for non-specific binding

Competition Assays:

  • Displacement of bound ATP by unlabeled ATP analogs

    • Useful for studying the effects of ATP structure modifications

    • Can detect sensitivity to ribose hydroxyl group modifications

    • Allows comparative analysis of ATP vs. other nucleotides

For all methods, include appropriate experimental controls (no protein, denatured protein, non-hydrolyzable ATP analogs) and account for potential detergent interference. When reporting results, include both binding constants and experimental conditions to facilitate comparison across studies.

How should researchers design complementation experiments to study KdpC function?

Designing effective complementation experiments for KdpC functional studies requires careful attention to genetic systems, construct design, and phenotypic analysis:

Genetic System Preparation:

  • Create a clean kdpC deletion strain

    • Use scarless deletion methods to avoid polar effects on kdpAB expression

    • Verify deletion by PCR, sequencing, and Western blotting

    • Confirm the phenotype (K+ uptake deficiency, growth defects in low K+ media)

  • Select appropriate vector systems

    • Use low-copy plasmids (pWSK29, pACYC184) to avoid overexpression artifacts

    • Include inducible promoters (PBAD, Ptac) for controlled expression

    • Ensure vector stability through appropriate selection markers

Complementation Construct Design:

  • Create a comprehensive mutation library

    • Point mutations targeting the conserved glutamine residue essential for ATP binding

    • Truncation series based on the finding that the four C-terminal amino acids are dispensable

    • Domain-swapping constructs between KdpC from E. coli and M. tuberculosis (compatible) or C. acetobutylicum (incompatible)

  • Include proper controls

    • Wild-type kdpC (positive control)

    • Empty vector (negative control)

    • Known non-functional mutant (additional negative control)

    • KdpC from M. tuberculosis (functional heterologous control)

Phenotypic Analysis:

  • Growth assays under potassium limitation

    • Test multiple K+ concentrations (0.1-10 mM)

    • Compare growth rates and final cell densities

    • Include rich media controls to verify general growth competence

  • Protein expression verification

    • Western blotting to confirm expression levels

    • Membrane fractionation to verify proper localization

    • Flow cytometry if using fluorescent protein fusions

  • Functional ATP binding assays

    • Use purified protein from complemented strains

    • Measure ATP binding using fluorescent ATP analogs

    • Compare binding affinities between wild-type and mutant variants

  • Statistical analysis

    • Perform experiments with biological triplicates

    • Apply appropriate statistical tests (t-test, ANOVA)

    • Report both effect sizes and statistical significance

This systematic approach allows comprehensive characterization of KdpC function through complementation analysis, following sound research methodology principles .

What techniques can reveal the structural changes in KdpC during ATP binding?

To investigate structural changes in KdpC during ATP binding, researchers should employ these complementary methodological approaches:

Spectroscopic Techniques:

  • Circular Dichroism (CD) Spectroscopy

    • Monitors changes in secondary structure upon ATP binding

    • Requires relatively small amounts of purified protein

    • Can detect substantial conformational changes in real-time

    • Compare spectra with/without ATP and non-hydrolyzable analogs

  • Fluorescence Spectroscopy

    • Utilizes intrinsic tryptophan fluorescence or introduced fluorescent probes

    • Can detect localized conformational changes

    • Particularly valuable when strategic cysteine mutations are introduced for labeling

    • Enables real-time monitoring of binding-induced changes

Advanced Structural Methods:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS)

    • Identifies regions with altered solvent accessibility upon ATP binding

    • Provides peptide-level resolution of conformational changes

    • Can be performed with membrane proteins in detergent micelles

    • Compares exchange rates in the presence/absence of ATP

  • Site-Directed Spin Labeling with Electron Paramagnetic Resonance (EPR)

    • Introduces spin labels at specific sites to monitor local environment changes

    • Can measure distances between labeled sites (DEER/PELDOR)

    • Works with membrane proteins in native-like environments

    • Especially valuable for tracking movement of KdpC relative to KdpB

  • Förster Resonance Energy Transfer (FRET)

    • Introduces donor/acceptor fluorophores at strategic positions

    • Measures distance changes upon ATP binding

    • Can be performed in reconstituted liposomes or nanodiscs

    • Allows real-time monitoring of structural dynamics

Crosslinking Approaches:

  • Chemical Crosslinking coupled with Mass Spectrometry

    • Uses bifunctional crosslinkers to capture interacting regions

    • Identifies differences in crosslinking patterns with/without ATP

    • Particularly useful for mapping the KdpC-KdpB interaction interface

    • Provides distance constraints for structural modeling

  • Photo-Affinity Labeling

    • Employs photoactivatable ATP analogs

    • Identifies residues directly involved in nucleotide binding

    • Confirms the involvement of the conserved glutamine residue

    • Provides precise binding site information

When implementing these techniques, researchers should maintain consistent buffer conditions, include appropriate controls (ATP vs. ADP, Mg2+ dependence), and combine multiple approaches to build a comprehensive model of KdpC structural dynamics during ATP binding.

How does the function of KdpC in E. coli compare with homologs in other bacterial species?

The function of KdpC shows notable similarities and differences across bacterial species, providing insights into evolutionary adaptation and functional conservation:

Functional Conservation:

KdpC functions as part of the KdpFABC complex for high-affinity K+ uptake across various bacterial species, with the complex being found among different bacterial groups . The core role of KdpC in ATP binding appears conserved, particularly the presence of a conserved glutamine residue important for nucleotide binding . Complementation experiments demonstrate that M. tuberculosis KdpC can functionally replace E. coli KdpC, suggesting conservation of core functional elements despite evolutionary distance .

Species-Specific Adaptations:

Despite functional conservation, significant species-specific adaptations exist. KdpC from C. acetobutylicum or Synechocystis cannot complement E. coli KdpC deletion, indicating divergence in protein-protein interactions or structural arrangements . Hybrid protein studies reveal domain-specific compatibility patterns, with some regions being interchangeable between species while others are not.

Comparative Functional Analysis of KdpC Across Species:

SpeciesComplementation in E. coliKey Functional Characteristics
E. coliYes (positive control)Forms KdpB/KdpC/ATP ternary complex ; Contains conserved glutamine for ATP binding
M. tuberculosisYesSufficient structural conservation to interact with E. coli KdpB; Likely contains functional equivalents of key residues
C. acetobutylicumNoN-terminal transmembrane segment or C-terminal third can be exchanged individually with E. coli
Synechocystis sp.NoInsufficient data on specific incompatibilities

Domain Compatibility Patterns:

Hybrid protein studies show that the N-terminal transmembrane segment and the C-terminal third of KdpC can be exchanged between E. coli and C. acetobutylicum individually, but simultaneous substitution of both regions is not functional . This pattern suggests co-evolution of the central region with other parts of the protein or with other subunits in the complex, highlighting the importance of species-specific protein-protein interactions in maintaining functional integrity of the KdpFABC complex.

This comparative analysis provides valuable insights for researchers studying evolutionary adaptation of membrane transport systems and helps guide the design of functional chimeric proteins for mechanistic studies.

What statistical approaches are most appropriate for analyzing KdpC activity data?

When analyzing KdpC activity data, researchers should select statistical approaches that align with their experimental design and data characteristics:

For Comparing ATP Binding or Hydrolysis:

  • Parametric Tests for Normally Distributed Data:

    • Student's t-test: For comparing two conditions (e.g., wild-type vs. single mutant)

    • ANOVA with post-hoc tests (Tukey's HSD): For comparing multiple conditions simultaneously (e.g., wild-type vs. several mutants)

    • Paired t-tests: When comparing the same samples under different conditions

  • Non-parametric Alternatives:

    • Mann-Whitney U test: Non-parametric alternative to t-test when data doesn't meet normality assumptions

    • Kruskal-Wallis with Dunn's post-hoc test: Non-parametric alternative to ANOVA

    • Wilcoxon signed-rank test: Non-parametric alternative to paired t-test

For Kinetic Data Analysis:

  • Non-linear Regression Models:

    • Michaelis-Menten equation: For standard enzyme kinetics

    • Hill equation: When investigating cooperativity in ATP binding

    • Competitive/non-competitive inhibition models: When studying inhibitor effects

  • Statistical Parameters to Report:

    • Km and Vmax values with confidence intervals

    • Hill coefficients for cooperative binding

    • R² values to indicate goodness of fit

    • Residual analysis to validate model assumptions

Experimental Design Considerations:

Statistical ApproachAppropriate ForSample Size RequirementsKey Assumptions
t-testComparing means between two groupsMinimum n=3-5 per groupNormal distribution, equal variances
ANOVAComparing means across multiple groupsMinimum n=3-5 per groupNormal distribution, equal variances, independence
Non-linear regressionFitting kinetic modelsMinimum 10-12 data points across concentration rangeAppropriate model selection, no systematic error
Mann-Whitney UNon-parametric comparison of two groupsMinimum n=5 per groupIndependent samples

Reporting Standards:

  • Include complete statistical information:

    • Test used and test statistic

    • Degrees of freedom

    • p-values (exact when possible)

    • Effect sizes (Cohen's d, R²)

  • Graphical presentation:

    • Include error bars (standard deviation or standard error)

    • Clearly indicate sample sizes

    • Show individual data points when possible

  • Address limitations:

    • Acknowledge potential sources of error

    • Discuss statistical power

    • Consider biological vs. statistical significance

Following these statistical approaches will ensure robust analysis of KdpC activity data while adhering to scientific rigor standards in research methodology3 . Researchers should select methods that balance sensitivity with appropriate control for experimental error, and consult with a biostatistician for complex experimental designs.

What are the most promising approaches for elucidating the complete mechanism of KdpC in the KdpFABC complex?

To fully elucidate the mechanism of KdpC in the KdpFABC complex, researchers should pursue these promising multidisciplinary approaches:

Structural Biology Approaches:

  • Cryo-electron microscopy of the intact KdpFABC complex in different conformational states

    • Capture the complex with and without ATP/ADP

    • Use nanodiscs to maintain a native-like membrane environment

    • Apply focused refinement techniques to resolve KdpC-KdpB interface details

  • Integrative structural biology combining:

    • X-ray crystallography of individual domains

    • NMR studies of smaller KdpC constructs

    • Crosslinking mass spectrometry data

    • Molecular dynamics simulations

Functional Studies:

  • Real-time conformational dynamics using:

    • Single-molecule FRET to track domain movements during ATP binding and hydrolysis

    • Time-resolved EPR spectroscopy with strategic spin labels

    • Stopped-flow spectroscopy to determine the sequence of conformational changes

  • Comprehensive mutagenesis focusing on:

    • The conserved glutamine residue essential for ATP binding

    • Predicted interface residues between KdpC and KdpB

    • Regions showing species-specific functional incompatibilities

Systems Biology Approaches:

  • Bioinformatic analysis of KdpC sequence variation across diverse bacterial species

    • Correlation of sequence features with environmental K+ availability

    • Co-evolutionary analysis to identify coordinated changes between KdpC and other subunits

    • Prediction of species-specific functional adaptations

  • Synthetic biology approaches:

    • Design of minimal KdpC constructs retaining ATP-binding function

    • Engineering chimeric transporters with enhanced properties

    • Creation of orthogonal K+ transport systems for biotechnological applications

Technological Innovations:

  • Development of high-throughput assays for:

    • ATP binding to KdpC variants

    • Conformational changes in the KdpC-KdpB interface

    • K+ transport in reconstituted systems

  • Application of advanced computational methods:

    • Machine learning to predict functional impacts of KdpC mutations

    • Molecular dynamics simulations of the complete KdpFABC complex

    • Quantum mechanics/molecular mechanics (QM/MM) studies of the ATP binding site

These approaches, used in combination, have the potential to provide a complete mechanistic understanding of KdpC's role in the KdpFABC complex, advancing our knowledge of this unique ATP-dependent potassium transport system and potentially revealing new paradigms in membrane transport mechanisms.

How might understanding KdpC function contribute to broader knowledge in bacterial physiology?

Understanding KdpC function has significant implications for broader knowledge in bacterial physiology, spanning from fundamental membrane transport mechanisms to potential applications in synthetic biology:

Fundamental Transport Mechanisms:

  • The KdpFABC complex represents a unique chimera of ion pumps and ion channels, with KdpC playing a distinctive role as a catalytic chaperone . Elucidating this mechanism provides insights into evolutionary adaptation of transport systems and may reveal new paradigms in membrane transport.

  • The nucleotide-binding mechanism involving KdpC differs from typical P-type ATPases but shares features with ABC transporters . Understanding this hybrid mechanism enriches our knowledge of how diverse transport systems evolved convergent solutions for energy coupling.

Bacterial Stress Responses:

  • The Kdp system is induced under potassium limitation, representing a key stress response mechanism. Detailed understanding of KdpC's role can illuminate how bacteria sense and respond to changing environmental conditions.

  • Potassium homeostasis is critical for bacterial survival, affecting numerous cellular processes including pH regulation, enzyme activity, and osmotic balance. KdpC's function in high-affinity K+ uptake directly impacts these fundamental physiological processes.

Species-Specific Adaptations:

  • The functional differences observed between KdpC from various bacterial species (e.g., E. coli vs. C. acetobutylicum) provide insights into how bacteria adapt transport systems to their specific environmental niches.

  • The ability of M. tuberculosis KdpC to complement E. coli KdpC deletion suggests conservation of functional mechanisms across phylogenetically distant bacteria, highlighting fundamental aspects of bacterial physiology.

Potential Applications:

  • Knowledge of KdpC function could inform the design of novel antimicrobials targeting bacterial potassium homeostasis, potentially effective against multiple bacterial species.

  • Engineering modified KdpC proteins with altered properties could lead to synthetic biology applications, such as creating bacteria with enhanced survival in potassium-limited environments for bioremediation purposes.

  • The unique ATP-binding mechanism involving KdpC might inspire the design of novel ATP-dependent molecular machines for biotechnological applications.

By thoroughly understanding KdpC's role in bacterial potassium transport, researchers gain insights not only into this specific protein but also into broader principles of membrane transport, bacterial adaptation, and potential biotechnological applications, ultimately contributing to our fundamental knowledge of bacterial physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.