Recombinant Escherichia coli Preprotein translocase subunit SecE (secE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
secE; prlG; b3981; JW3944; Protein translocase subunit SecE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
secE
Target Protein Sequence
MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRALAVVILIAAAGGVAL LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS FITGLRF
Uniprot No.

Target Background

Function
SecE is an essential subunit of the bacterial protein translocation channel SecYEG. It functions by clamping together the two halves of SecY and may interact with the channel plug during translocation. While overexpression of certain SecE hybrid proteins has been associated with cell death, potentially by jamming the protein secretion apparatus, this effect is also countered by FtsH-mediated degradation of SecY.
Database Links
Protein Families
SecE/SEC61-gamma family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What methodologies can distinguish the functional contributions of SecG versus SecE in protein translocation?

    Differentiating between SecE and SecG functions requires sophisticated experimental approaches:

    1. Genetic depletion studies: Comparative analysis of strains with ΔsecG mutations versus SecE depletion reveals distinct phenotypes. While SecE is essential for viability, SecG deletion produces cold-sensitive phenotypes and reduced translocation efficiency .

    2. Biochemical complementation assays: IMVs (inverted membrane vesicles) containing different relative amounts of SecYE, SecG, and SecDFyajC prepared from various E. coli strains (wild-type, ΔsecG::kan, and SecDFyajC-depleted) allow quantitative assessment of each component's contribution .

    3. SecA insertion/deinsertion cycle analysis: This reveals that SecG specifically stimulates SecA insertion after initiation of translocation, while SecDFyajC stabilizes the inserted form of SecA .

    These approaches collectively demonstrate that while SecYE forms the essential core, SecG plays a critical role by facilitating the ATP-driven cycle of SecA membrane insertion at different stages of the translocation reaction .

  • How can researchers investigate the interactions between SecE and SecA during the membrane insertion/deinsertion cycle?

    Investigating SecE-SecA dynamics during membrane cycling requires specialized techniques:

    1. Protease protection assays: These detect conformational changes in SecA by exposing membrane preparations to proteases, revealing domains that become protected during the insertion process .

    2. In vivo cross-linking with membrane-impermeant probes: This technique shows that some SecA bound at SecYEG is accessible from the periplasm in cells with permeabilized outer membrane but intact plasma membrane .

    3. SecA membrane insertion assays: These typically measure the proportion of SecA that becomes resistant to proteolysis or extraction with urea, indicating insertion into the membrane .

    4. Formaldehyde cross-linking in intact cells: This specifically identifies SecA cross-linked to SecY, demonstrating their close association during the translocation cycle .

    The data from these experiments supports a model where SecA undergoes cycles of membrane insertion and deinsertion during protein translocation, with specific domains becoming exposed to the periplasm during this process .

  • What experimental approaches are effective for studying the oligomeric state of the SecYEG complex?

    The oligomeric organization of SecYEG can be studied through several complementary methods:

    1. Blue native PAGE: This technique separates protein complexes in their native state and can reveal the stoichiometry of SecYEG components .

    2. Chemical cross-linking followed by immunoblotting: This approach captures transient interactions between subunits, helping to determine proximity relationships within the complex .

    3. Fluorescence resonance energy transfer (FRET): By tagging different subunits with fluorescent probes, researchers can measure distances between components and monitor dynamic changes during the translocation process .

    4. Analytical ultracentrifugation: This technique provides information about the molecular weight and shape of protein complexes in solution, helping to determine oligomeric states.

    5. Co-immunoprecipitation with differentially tagged subunits: Using strains expressing differently tagged versions of SecE (e.g., HA-tagged) allows determination of whether multiple copies of the same subunit exist in a single complex .

    Research has demonstrated that SecYEG can exist in different oligomeric states, potentially as a functional dimer during translocation, though the exact arrangement remains an area of active investigation .

  • What approaches can be used to study the specific contribution of SecE to preprotein translocation kinetics?

    Investigating SecE's specific kinetic contributions requires isolation of this component's effects from other translocase subunits:

    1. Reconstitution experiments with defined components: By systematically varying the concentration of purified SecE in proteoliposomes containing fixed amounts of other components, researchers can determine its specific contribution to translocation rates .

    2. Translocation rate analysis using radioactively labeled preproteins: This approach measures the initial rates of translocation as a function of preprotein concentration in systems with controlled levels of SecE .

    3. Pre-steady-state kinetic analysis: Using rapid mixing techniques and fluorescently labeled preproteins, researchers can identify rate-limiting steps in translocation that may be influenced by SecE.

    4. Temperature-dependent kinetic studies: Since SecE mutants often display temperature-sensitive phenotypes, conducting translocation assays across a temperature range can reveal specific kinetic parameters affected by SecE function .

    Experimental data indicates that while SecYE is sufficient to activate SecA as a preprotein-dependent ATPase, overproduction of SecYE does not result in a proportional increase in preprotein translocation, suggesting complex kinetic relationships .

  • How can researchers develop effective strategies for purifying functional recombinant SecE for structural and biochemical studies?

    Purification of functional SecE presents challenges due to its membrane protein nature. Effective strategies include:

    1. Expression systems optimization:

      • Cell-free expression systems

      • E. coli-based expression with careful control of induction conditions

      • Fusion to solubility-enhancing tags (e.g., His-tag)

    2. Quality control assessments:

      • SDS-PAGE analysis (>90% purity)

      • Mass spectrometry for identity confirmation

      • Functional reconstitution to verify activity

    3. Storage optimization:

      • Buffer composition: Tris/PBS-based buffer with 50% glycerol

      • Temperature: -20°C/-80°C for extended storage

      • Avoiding repeated freeze-thaw cycles

    4. Reconstitution methods:

      • Incorporation into proteoliposomes for functional studies

      • Complex formation with SecY and SecG to reconstruct the native SecYEG complex

    These approaches ensure the purified SecE retains its native structure and functionality for subsequent experimental applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.