Recombinant Escherichia coli Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

ArnE is a 111–114 amino acid subunit encoded by the arnE gene in E. coli and related pathogens . It participates in the polymyxin resistance (Pmr) system, which modifies lipid A (a component of lipopolysaccharide) by adding L-Ara4N groups. This modification alters membrane permeability and confers resistance to antimicrobial peptides like polymyxins .

Key Functions:

  • Flippase Activity: Collaborates with ArnF to translocate undecaprenyl phosphate-α-L-Ara4N across the inner membrane .

  • Regulatory Interactions: Modulates expression of virulence genes (e.g., aafA) via AggR and H-NS, impacting pathogenicity in enteroaggregative E. coli .

Production Methods

ArnE is heterologously expressed in E. coli using T7-based systems (e.g., pET vectors) with His-tagged fusion partners for purification . Key optimizations include:

  • Strain Selection: BL21(DE3) or Rosetta-gami strains to enhance solubility .

  • Purification: Ni-NTA affinity chromatography followed by gel filtration .

  • Yield: >90% purity as determined by SDS-PAGE .

Functional Studies

StudyFindingsSource
Lipid A ModificationArnE-ArnF complex required for flipping undecaprenyl phosphate-α-L-Ara4N
Antimicrobial ResistanceL-Ara4N addition reduces polymyxin binding to lipid A, enhancing survival
Regulatory NetworkAar (AggR regulator) modulates ArnE expression via H-NS in EAEC strains

Pathogenicity and Drug Resistance

ArnE’s role in lipid A modification is critical for bacterial survival under antimicrobial stress. In Salmonella and E. coli, this system is linked to virulence and polymyxin resistance .

Biotechnological Potential

ArnE may serve as a target for antimicrobial agents disrupting lipid A modification. Recombinant expression systems (e.g., E. coli) enable high-yield production for structural and enzymatic assays .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
arnE; ECSE_2517; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli (strain SE11)
Target Names
arnE
Target Protein Sequence
MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV
Uniprot No.

Target Background

Function
This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant ArnE production?

E. coli remains the dominant expression system for recombinant ArnE production due to its established protocols and genetic tractability. The most effective expression systems include:

Expression SystemAdvantagesLimitationsBest Applications
E. coli BL21(DE3)High yield, economicalPotential toxicity issuesInitial screening
E. coli C41(DE3)/C43(DE3)Better for toxic proteinsLower expression levelsMembrane proteins like ArnE
Single Protein Production (SPP)Exclusive target protein expressionTechnical complexityHighly toxic proteins
Secretion systems (Sec/SRP)Reduced toxicityLower yieldsWhen cytoplasmic expression fails

For membrane proteins like ArnE, specialized E. coli strains such as C41(DE3) and C43(DE3) are particularly valuable as they contain mutations in the lacUV5 promoter that reduce expression levels to more tolerable amounts, preventing cell death during expression of potentially toxic membrane proteins .

How should experiments involving recombinant ArnE be designed to ensure statistical validity?

Experimental design for ArnE studies should adhere to three key principles: blinding, randomization, and adequate group sizes. According to the British Journal of Pharmacology guidelines:

  • Blinding: Researchers should be blinded to treatment groups during data collection and analysis to prevent unconscious bias.

  • Randomization: Experimental units should be randomly assigned to treatment groups. For ArnE expression studies, this might involve random allocation of culture flasks to different induction conditions.

  • Group sizing: Sample sizes should be determined through power analysis prior to experimentation .

The appropriate statistical model for analyzing ArnE expression data in a completely randomized design is:

Yij=μ+τi+ϵijY_{ij} = \mu + \tau_i + \epsilon_{ij}

Where:

Analysis of variance (ANOVA) is typically used to determine statistical significance between different expression conditions, with post-hoc tests to identify specific group differences.

What are the optimal methods for ArnE purification and how can purity be verified?

Purification of ArnE typically employs affinity chromatography, leveraging His-tagged constructs. The general workflow includes:

  • Cell lysis: Osmotic shock or mechanical disruption methods are preferred for membrane proteins.

  • Membrane fraction isolation: Ultracentrifugation at 100,000×g to separate membrane fractions.

  • Solubilization: Detergent-based extraction (commonly with mild detergents like DDM or LDAO).

  • Affinity purification: Using Ni-NTA resin for His-tagged ArnE.

  • Verification: SDS-PAGE analysis should show >90% purity, with expected molecular weight of approximately 12-13 kDa for the ArnE protein .

Western blotting with anti-His antibodies provides additional verification of identity and can detect even low expression levels. Mass spectrometry can provide definitive identification and sequence coverage confirmation.

How does ArnE contribute to antimicrobial resistance mechanisms and what implications does this have for therapeutic development?

ArnE plays a crucial role in lipid translocation mechanisms that modify bacterial outer membranes, specifically in the translocation of 4-amino-4-deoxy-L-arabinose-modified lipids. This modification alters the charge characteristics of the bacterial outer membrane, reducing the binding affinity of cationic antimicrobial peptides and some antibiotics.

The arnE gene is part of a broader resistance machinery that includes multiple genes involved in membrane modification. Research approaches to study this system include:

  • Gene knockout studies: Comparative analysis of wild-type vs. ΔarnE strains for antimicrobial susceptibility.

  • Structural biology: Determining protein-ligand interactions through crystallography or cryo-EM studies.

  • Small molecule screening: Identifying inhibitors that block ArnE function and potentially restore antimicrobial sensitivity .

The therapeutic potential lies in developing adjuvants that inhibit ArnE function, thereby restoring bacterial susceptibility to existing antibiotics - a strategy that could extend the useful life of our current antimicrobial arsenal.

What biotechnological applications could utilize engineered ArnE proteins?

Lipid flippases like ArnE have emerging biotechnological applications based on their membrane-modifying capabilities:

  • Crop improvement: Modified lipid flippases may enhance plant stress responses. For example, studies with the plant P4-ATPase ALA10 (a related flippase) showed that overexpression improved cold temperature adaptation and potentially drought resistance through changes in membrane fluidity .

  • Biosensor development: Engineered flippases could report on membrane perturbations in response to environmental toxins.

  • Drug delivery systems: Modified flippases might facilitate controlled release of compounds across biological barriers.

For successful application, researchers must consider:

  • Protein stability in heterologous systems

  • Functional conservation across species

  • Potential pleiotropic effects of expression

Preliminary studies suggest that targeted modification of flippase expression could result in organisms with enhanced resilience to multiple stressors simultaneously .

How can toxicity issues during recombinant ArnE expression be addressed?

Membrane proteins like ArnE often exhibit toxicity when overexpressed. Several strategies can mitigate this challenge:

StrategyMethodologyMechanismEffectiveness
Specialized host strainsUse C41(DE3)/C43(DE3)Reduced T7 RNA polymerase levelsHigh for many toxic proteins
Secretion strategiesFusion with signal peptides (PelB, DsbA)Export from cytoplasmVariable effectiveness
Inducible systemsFine-tuning expression with titrated inducersControlled expression ratesModerate to high
Single Protein ProductionMazF-mediated arrest of host protein synthesisACA-less construct survives while other translation haltsExcellent for highly toxic proteins

The Single Protein Production (SPP) system is particularly promising, as it converts E. coli into a bioreactor producing only the target protein. In this system, the MazF mRNA interferase selectively cleaves ACA sequences in cellular mRNAs, causing complete growth arrest. By engineering the target protein mRNA to be devoid of ACA sequences, it remains resistant to MazF cleavage, allowing exclusive expression of the protein of interest .

For ArnE specifically, secretion to the periplasm via the SRP pathway using the DsbA signal sequence has shown success for similar membrane proteins, as it routes the protein directly to the membrane and reduces cytoplasmic accumulation .

What approaches can address codon bias issues in heterologous ArnE expression?

Codon bias occurs when the frequency of codons in the foreign DNA differs significantly from that of the host organism. For ArnE expression, consider these methodological solutions:

  • Codon optimization: Redesign the gene sequence while maintaining the amino acid sequence. Tools like GenScript's optimization algorithm can adapt the sequence to E. coli's preferences.

  • Supply of rare tRNAs: Use strains like Rosetta™ or CodonPlus® that contain additional tRNA genes for rare codons.

  • Identification of problematic regions: Analyze the ArnE sequence for clusters of rare codons (AGG, AGA, CGA for arginine; ATA for isoleucine; CTA for leucine) that occur at a frequency <1% in E. coli .

  • Synthetic gene synthesis: For complete redesign with optimal codon adaptation index (CAI).

The effectiveness of these approaches can be assessed by comparing expression levels between native and optimized sequences under identical conditions, typically showing 2-10 fold improvements in protein yield.

What statistical approaches are recommended for analyzing variability in ArnE expression studies?

Robust statistical analysis for ArnE expression studies should include:

  • Descriptive statistics: Report means with standard error of the mean (s.e.mean) rather than standard deviation for biological replicates.

  • Inferential statistics: Apply ANOVA for multi-group comparisons, followed by appropriate post-hoc tests (Tukey's HSD for all pairwise comparisons or Dunnett's test when comparing to a control).

  • Sample size determination: Calculate required sample sizes based on:

    • Expected effect size

    • Desired power (typically 0.8)

    • Alpha level (typically 0.05)

  • Transformation of data: Consider log transformation for expression data that spans multiple orders of magnitude.

  • Variance homogeneity: Test using Levene's test; consider alternative non-parametric methods if assumptions are violated .

When reporting results, clearly specify the statistical tests used, exact p-values, and confidence intervals rather than simply indicating significance thresholds.

How should contradictory findings regarding ArnE function be approached in research?

When encountering contradictory findings in ArnE research:

  • Systematic analysis of methodological differences: Create a comparison table documenting variations in:

    • Expression systems

    • Purification protocols

    • Functional assay conditions

    • Protein tagging and modifications

  • Reproducibility assessment: Attempt to replicate conflicting findings using standardized protocols.

  • Collaborative verification: Engage with research groups reporting contradictory results for cross-laboratory validation.

  • Context-dependent function analysis: Investigate whether ArnE function varies based on:

    • Bacterial strain backgrounds

    • Growth conditions

    • Presence of interacting proteins

    • Post-translational modifications

  • Meta-analysis approach: When sufficient published data exists, perform a systematic review with defined inclusion criteria and quantitative synthesis of findings .

This methodical approach helps distinguish genuine biological variability from technical artifacts and builds a more comprehensive understanding of ArnE function.

What emerging technologies show promise for advancing ArnE research?

Several cutting-edge approaches are poised to transform our understanding of ArnE:

  • Cryo-electron microscopy: For high-resolution structural determination of ArnE in its native membrane environment, potentially revealing conformational states during substrate transport.

  • Recombineering with CRISPR/Cas9: Enabling precise genomic modifications to study ArnE function through techniques such as:

    • Counter-selection following recombineering

    • Assembly of linear dsDNA fragments

    • Retrieval of alleles onto plasmids by gap repair

  • Native mass spectrometry: For analyzing intact membrane protein complexes including ArnE and its potential interaction partners.

  • Single-molecule tracking: To visualize ArnE dynamics in living bacterial cells using techniques like PALM or STORM microscopy.

  • Synthetic biology approaches: Engineering minimal membrane systems with defined lipid compositions to dissect ArnE function in controlled environments.

These technologies will help bridge current knowledge gaps regarding the structural dynamics, partner interactions, and precise mechanism of ArnE-mediated lipid flipping.

How might comparative genomics inform our understanding of ArnE evolution and function?

Comparative genomics approaches offer valuable insights into ArnE evolution and functional conservation:

  • Phylogenetic analysis: Constructing evolutionary trees of ArnE homologs across bacterial species to identify conserved and divergent regions that may correlate with functional specialization.

  • Synteny analysis: Examining the genomic context of arnE genes across species to identify frequently co-occurring genes that may function in related pathways.

  • Selection pressure analysis: Calculating dN/dS ratios to identify regions under positive, neutral, or purifying selection, revealing functionally critical domains.

  • Horizontal gene transfer assessment: Determining if arnE genes exhibit evidence of lateral transfer between bacterial lineages, potentially correlating with antimicrobial resistance spread.

  • Structure prediction: Using multiple sequence alignments of diverse ArnE homologs to improve structural models through evolutionary coupling analysis.

This evolutionary perspective can reveal functional constraints on ArnE sequence and structure, potentially identifying conserved sites for targeted inhibitor development or engineering.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.