Recombinant Escherichia coli Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

Biological Role and Functional Mechanism

ArnF (formerly PmrM) forms a heterodimeric flippase complex with ArnE (PmrL) to transport undecaprenyl phosphate-α-L-Ara4N (a lipid-linked sugar donor) from the cytoplasmic to the periplasmic side of the inner membrane . This process enables the transfer of the 4-amino-4-deoxy-L-arabinose (L-Ara4N) moiety to lipid A, a modification critical for:

  • Resistance to polymyxin antibiotics (e.g., colistin) .

  • Reduced binding of cationic antimicrobial peptides to the bacterial outer membrane .

Without ArnF/ArnE, undecaprenyl phosphate-α-L-Ara4N accumulates on the cytoplasmic membrane surface, rendering bacteria susceptible to polymyxins .

Key Studies:

  1. Role in Lipid A Modification

    • Inactivation of arnF in polymyxin-resistant pmrA<sup>c</sup> E. coli abolishes L-Ara4N attachment to lipid A, restoring polymyxin sensitivity .

    • Lipid A modification reduces net negative charge, limiting polymyxin binding .

  2. Flippase Activity Validation

    • Periplasmic accessibility of undecaprenyl phosphate-α-L-Ara4N decreases 4–5-fold in arnF mutants, confirmed via sulfo-NHS-biotin labeling .

  3. Recombinant Strain Optimization

    • Strains like E. coli SuptoxRNE22 enhance membrane protein yields by modulating RNase E activity, relevant for large-scale ArnF production .

Comparative Analysis of ArnF-Associated Gene Nomenclature

Functional NameSalmonella HomologE. coli Gene IDRole in L-Ara4N Pathway
ArnFPmrMb2258Flippase subunit
ArnEPmrLb4544Flippase subunit
ArnTPmrKb2257L-Ara4N transferase .

Challenges in Recombinant Production

  • Inclusion body formation: Addressed using strains like SHuffle or Origami, which promote disulfide bond correction .

  • Toxicity: Mitigated via RNase E truncations or RraA co-expression in specialized strains (e.g., SuptoxRNE22) .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill them accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery estimates, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the product for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing it accordingly.
Synonyms
arnF; EC55989_2506; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Escherichia coli (strain 55989 / EAEC)
Target Names
arnF
Target Protein Sequence
MGLMWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF LPMTKQRY
Uniprot No.

Target Background

Function
This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane, moving it from the cytoplasmic side to the periplasmic side.
Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of the ArnF subunit in E. coli and how does it relate to antimicrobial resistance mechanisms?

ArnF functions as a crucial component in the lipopolysaccharide (LPS) modification pathway in E. coli, specifically as part of the 4-amino-4-deoxy-L-arabinose (Ara4N) transport system. This subunit works as a flippase, facilitating the translocation of Ara4N-modified lipid carriers across the cytoplasmic membrane. The primary function of this system is to modify the lipid A component of LPS with Ara4N, which reduces the negative charge of the bacterial outer membrane and subsequently decreases the binding affinity of cationic antimicrobial peptides and certain antibiotics, thus conferring resistance.

The mechanism involves several steps similar to those observed in other bacterial flippase systems, where ArnF works in conjunction with other Arn proteins to facilitate the complete modification process. To study this pathway effectively, researchers typically employ genetic knockout studies combined with antimicrobial susceptibility testing, lipid A structural analysis, and membrane protein interaction assays. Recent methodological approaches have included fluorescence microscopy to track protein localization in living cells, which can provide valuable insights into the spatial organization and dynamics of ArnF during the resistance response .

How do the structural characteristics of ArnF determine its function as a phosphoundecaprenol flippase?

ArnF possesses multiple transmembrane domains characteristic of flippase proteins involved in translocating lipid-linked substrates across biological membranes. Its structure typically includes:

  • Multiple membrane-spanning α-helical domains (approximately 10-12 transmembrane segments)

  • Conserved charged amino acid residues in the transmembrane domains that facilitate substrate recognition

  • Cytoplasmic and periplasmic loops that interact with other components of the Ara4N modification system

The structural arrangement creates a hydrophilic pathway through which the hydrophilic head group of the Ara4N-phosphoundecaprenol can be translocated while the hydrophobic undecaprenol tail remains within the membrane bilayer. This conformation allows the protein to function as a flippase without disrupting membrane integrity.

To investigate these structural characteristics, researchers typically employ protein structural prediction tools, site-directed mutagenesis of conserved residues, and membrane protein topology studies. Advanced research has utilized fluorescence resonance energy transfer (FRET) techniques to map proximity relationships between transmembrane segments and identify conformational changes associated with substrate binding and translocation.

What are the optimal expression systems and conditions for producing recombinant ArnF in E. coli?

The expression of recombinant ArnF presents significant challenges due to its hydrophobic nature as a membrane protein. Based on experimental approaches similar to those used for other membrane proteins, the following optimized protocol has been developed:

Table 2.1: Optimized Expression Conditions for Recombinant ArnF

ParameterOptimal ConditionAlternative Approaches
Expression VectorpET21a with C-terminal His6-tagpET28a with N-terminal His6-tag
Host StrainE. coli Rosetta(DE3)C41(DE3) or C43(DE3) for toxic membrane proteins
Induction Temperature16-18°C25°C for improved folding
IPTG Concentration0.1-0.5 mM1 mM for higher expression
Expression Duration16-18 hours4-6 hours at higher temperatures
Media CompositionTerrific Broth with 0.5% glucoseLB with 1% glycerol

To achieve optimal expression, it is essential to employ a strategy similar to that used for RecN, where the gene is amplified from E. coli genomic DNA (preferably strain MG1655) and cloned into an expression vector using appropriate restriction sites . The construct should incorporate a C-terminal polyhistidine tag for purification, and the expression protocol should include careful monitoring of cell density (OD600) before induction.

For membrane proteins like ArnF, researchers should be particularly attentive to potential cytotoxicity during overexpression, which may necessitate using specialized E. coli strains like C41(DE3) or C43(DE3) that are better adapted to express membrane proteins. Additionally, the addition of membrane-stabilizing agents such as glycerol (1%) to the growth medium can enhance protein stability and yield.

What purification strategies yield functional ArnF protein with optimal purity and stability?

Purification of ArnF requires specialized techniques due to its hydrophobic nature as a membrane protein. The following step-by-step methodology has been optimized based on similar membrane protein purification approaches:

  • Membrane Isolation:

    • Harvest cells by centrifugation (6,000×g, 15 min, 4°C)

    • Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Disrupt cells using French press or sonication

    • Remove unbroken cells and debris by centrifugation (10,000×g, 20 min, 4°C)

    • Isolate membranes by ultracentrifugation (100,000×g, 1 hr, 4°C)

  • Solubilization:

    • Resuspend membrane pellet in solubilization buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol)

    • Add detergent mixture (1% n-dodecyl-β-D-maltopyranoside [DDM] and 0.2% cholesteryl hemisuccinate [CHS])

    • Incubate with gentle rotation for 2 hours at 4°C

    • Remove insoluble material by ultracentrifugation (100,000×g, 30 min, 4°C)

  • Affinity Purification:

    • Apply solubilized membrane fraction to Ni-NTA affinity column

    • Wash with 10-20 column volumes of wash buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 0.05% DDM, 20 mM imidazole)

    • Elute with elution buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 0.05% DDM, 300 mM imidazole)

  • Size Exclusion Chromatography:

    • Apply concentrated eluate to a Superdex 200 column equilibrated with SEC buffer (50 mM Tris-HCl pH 8.0, 150 mM NaCl, 5% glycerol, 0.03% DDM)

    • Collect fractions and analyze by SDS-PAGE

This protocol has been adapted from successful membrane protein purification methodologies and incorporates techniques similar to those used for RecN purification, where Ni-NTA affinity chromatography has shown effectiveness . For functional studies, it is crucial to verify protein folding and stability using circular dichroism spectroscopy and thermal shift assays to ensure that the purified protein maintains its native conformation.

What experimental approaches can effectively demonstrate the flippase activity of purified recombinant ArnF?

Demonstrating flippase activity for membrane proteins like ArnF presents unique challenges that require specialized experimental approaches. The following methodologies have been optimized for functional characterization:

Table 3.1: Flippase Activity Assay Methods for ArnF

Assay TypePrincipleExperimental SetupData Analysis
Fluorescent Lipid TranslocationMeasures movement of fluorescently labeled lipid analogsReconstituted proteoliposomes with NBD-labeled lipidsFluorescence quenching analysis
ATP Hydrolysis CouplingMeasures ATP consumption during substrate translocationPurified protein + ATP + lipid substrateColorimetric phosphate release quantification
Radioactive Substrate TransportTracks movement of radiolabeled Ara4N precursorsRadiolabeled substrates with reconstituted membrane vesiclesScintillation counting of transported substrates
Accessibility AssayDetermines substrate exposure to opposing membrane facesChemically modified substrates with membrane-impermeable reagentsMass spectrometry analysis of modified lipids

The fluorescent lipid translocation assay represents the most direct approach for examining flippase activity. In this method, ArnF is reconstituted into liposomes containing fluorescently labeled lipid analogs that mimic the natural substrate. The translocation activity can be monitored through changes in fluorescence as the labeled lipids move from one leaflet to another, similar to the fluorescence microscopy techniques used to monitor protein localization in living cells .

ATP hydrolysis coupling assays can provide indirect evidence of flippase activity, as many flippases like ArnF have both intrinsic and substrate-stimulated ATPase activity. This is comparable to the ATP-dependent DNA binding observed for RecN protein , where ATPase activity is stimulated by the presence of substrate. Researchers should establish baseline ATPase activity and then measure the enhancement when the lipid substrate is added to confirm substrate-specific activity.

For all these assays, appropriate controls including protein-free liposomes and inactive mutant variants of ArnF (e.g., ATPase-deficient mutants) should be included to establish specificity of the observed activities.

How can researchers design experiments to elucidate the interaction of ArnF with other components of the 4-amino-4-deoxy-L-arabinose modification pathway?

Investigating protein-protein interactions within the 4-amino-4-deoxy-L-arabinose modification pathway requires systematic experimental designs that capture both binary interactions and functional complexes. The following methodological approach can be implemented:

  • Co-immunoprecipitation Studies:

    • Express recombinant ArnF with epitope tags (e.g., FLAG, HA)

    • Express potential interaction partners with different tags (e.g., His6, GST)

    • Perform pulldown assays using tag-specific antibodies

    • Analyze co-precipitated proteins by Western blotting or mass spectrometry

  • Bacterial Two-Hybrid Analysis:

    • Clone ArnF and potential interaction partners into bacterial two-hybrid vectors

    • Transform into reporter strains and measure reporter gene activation

    • Quantify interaction strength using β-galactosidase assays

  • Fluorescence Microscopy Co-localization:

    • Generate fusion proteins with different fluorescent tags (e.g., ArnF-mCherry)

    • Express in E. coli cells under control of inducible promoters

    • Visualize protein localization using fluorescence microscopy

    • Quantify co-localization coefficients

For fluorescence microscopy studies, researchers can follow a protocol similar to that described for RecN-mCherry fusion protein, where cells carrying the expression plasmid are grown to an OD600 of 0.3, induced with IPTG, and then imaged after an additional growth period . This approach allows for visualization of protein localization in living cells and can provide insights into dynamic interactions during the antimicrobial resistance response.

For more detailed interaction mapping, fractional factorial design (FFD) approaches can be employed to systematically test multiple interaction conditions while minimizing the number of experiments required. This experimental design strategy is particularly effective when investigating complex multi-protein systems like the Arn pathway .

How can computational approaches and molecular dynamics simulations enhance our understanding of ArnF structure-function relationships?

Computational approaches provide powerful tools for investigating membrane proteins like ArnF where traditional structural determination methods face significant challenges. A comprehensive computational workflow for ArnF structure-function analysis includes:

  • Homology Modeling and Threading:

    • Identify structural homologs through sequence similarity searches

    • Generate multiple alignment with related flippase proteins

    • Construct 3D models using Rosetta, MODELLER, or AlphaFold2

    • Validate models using ProCheck, VERIFY3D, and ERRAT

  • Molecular Dynamics Simulations:

    • Embed protein models in lipid bilayer membranes that mimic E. coli inner membrane

    • Perform energy minimization and equilibration

    • Conduct production runs (100-500 ns) with explicit solvent

    • Analyze protein stability, conformational changes, and lipid interactions

  • Substrate Docking and Transport Pathway Analysis:

    • Generate 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol substrate models

    • Perform molecular docking to identify binding sites

    • Map potential translocation pathways using techniques like CAVER

    • Calculate energy profiles along proposed transport paths

  • Machine Learning Integration:

    • Apply machine learning algorithms to identify structure-function patterns

    • Implement Maximum A Posteriori (MAP) estimation approaches to analyze simulation data

    • Use extended-connectivity fingerprint-based deep neural networks (ECFP-based DNN) for binding site prediction

The integration of machine learning approaches, particularly those using MAP estimation loss functions, can significantly enhance the analysis of complex structural data by reducing noise and identifying significant patterns, similar to their application in other biological datasets . These computational predictions should guide experimental design, particularly for site-directed mutagenesis studies targeting residues predicted to be crucial for substrate recognition or translocation.

For validation of computational models, researchers should design fractional factorial experiments (FFD) that test key predictions while minimizing the number of experimental variables, following established methodologies for experimental design optimization .

What role does ArnF play in antibiotic resistance, and how can this knowledge inform novel antimicrobial development strategies?

ArnF plays a critical role in antimicrobial resistance through its function in the 4-amino-4-deoxy-L-arabinose modification pathway. This pathway modifies lipopolysaccharide (LPS) by adding positively charged Ara4N groups to lipid A, reducing the negative charge of the bacterial outer membrane and decreasing its affinity for cationic antimicrobial peptides and polymyxin antibiotics. Understanding this mechanism provides several avenues for novel antimicrobial development:

Table 4.2: ArnF-Targeted Antimicrobial Development Strategies

StrategyMechanismExperimental ApproachPotential Advantages
Direct ArnF InhibitionBlocks flippase activityHigh-throughput screening with reconstituted ArnFSpecific targeting of resistance mechanism
Allosteric ModulationAlters ArnF conformationStructure-based drug designMay overcome direct binding site mutations
Disruption of Protein-Protein InteractionsPrevents complex formationTwo-hybrid screening for interaction disruptorsCan target multiple components simultaneously
Substrate Competitive InhibitorsCompetes with natural substrateRational design of Ara4N analogsPotentially high specificity
Combination TherapyTargets ArnF pathway and primary antibiotic targetCheckerboard assays for synergyOvercomes multiple resistance mechanisms

To investigate these strategies experimentally, researchers can design a systematic approach:

  • Generate recombinant E. coli strains with controlled expression of ArnF (both wild-type and mutant variants)

  • Determine minimum inhibitory concentrations (MICs) of various antibiotics against these strains

  • Perform time-kill assays to characterize the dynamics of antibiotic activity

  • Use fluorescence microscopy to monitor bacterial membrane integrity and potential inhibitor effects on ArnF localization

  • Employ molecular dynamics simulations to predict binding modes of potential inhibitors

This research direction has significant translational potential, as compounds that inhibit ArnF or other components of the Ara4N modification pathway could serve as adjuvants to restore the effectiveness of existing antibiotics against resistant gram-negative bacteria. The experimental design should follow fractional factorial approaches to efficiently test combinations of potential inhibitors with various antibiotics .

What are the common challenges in expressing and purifying functional recombinant ArnF, and how can these be addressed?

Membrane proteins like ArnF present numerous challenges during recombinant expression and purification. The following table outlines common issues and their methodological solutions:

Table 5.1: Troubleshooting Guide for ArnF Expression and Purification

ChallengePossible CausesSolution StrategiesSuccess Indicators
Low Expression YieldToxicity to host cellsUse C41/C43(DE3) strains; lower induction temperature; use tightly controlled promotersImproved cell density; visible protein band on SDS-PAGE
Inclusion Body FormationRapid expression; improper foldingReduce IPTG concentration (0.1-0.2 mM); add glycerol (5-10%); express at 16°CIncreased protein in membrane fraction vs. inclusion bodies
Poor SolubilizationInadequate detergent selectionScreen detergent panel (DDM, LMNG, digitonin); optimize detergent:protein ratioIncreased protein in soluble fraction after ultracentrifugation
Protein InstabilityLoss of essential lipidsAdd lipid mixtures (E. coli polar lipids); include cholesterol hemisuccinateImproved monodispersity on size exclusion chromatography
Low PurityNon-specific binding to resinOptimize imidazole in wash buffers; add low concentrations of competing detergentsSingle band on SDS-PAGE; >90% purity by densitometry
Loss of FunctionDetergent-induced conformational changesUse milder detergents; consider nanodisc or liposome reconstitutionRetained ATPase activity; substrate binding capacity

To implement these solutions effectively, researchers should employ an experimental design approach similar to fractional factorial designs (FFD) to systematically optimize multiple parameters while minimizing the number of experiments . This approach is particularly valuable when dealing with membrane proteins like ArnF, where multiple interdependent factors affect expression and purification outcomes.

For expression optimization, researchers can follow protocols similar to those used for RecN, adapting the expression vector design, host strain selection, and induction conditions to accommodate the membrane protein nature of ArnF . The monitoring of protein expression can be enhanced by creating C-terminal fusion proteins with fluorescent tags like mCherry, allowing for direct visualization of expression levels and localization patterns in living cells before proceeding to large-scale purification.

How can researchers develop reliable assays to distinguish between specific ArnF activity and non-specific membrane effects in functional studies?

Developing specific assays for membrane proteins is challenging due to the complexity of membrane environments and potential artifacts. The following methodological framework ensures reliable distinction between specific ArnF activity and non-specific effects:

  • Control System Development:

    • Generate catalytically inactive ArnF mutants (e.g., ATPase-deficient variants)

    • Express and purify mutant proteins using identical protocols to wild-type

    • Confirm structural integrity through circular dichroism and thermal stability assays

    • Use these as negative controls in all functional assays

  • Substrate Specificity Validation:

    • Test activity with natural substrate and structural analogs

    • Determine kinetic parameters (Km, Vmax) for each substrate

    • Plot structure-activity relationships to identify essential substrate features

    • Confirm specificity through competition assays

  • Reconstitution System Optimization:

    • Compare multiple reconstitution methods (direct incorporation, detergent dialysis, liposome fusion)

    • Test various lipid compositions reflecting E. coli inner membrane

    • Measure protein orientation in proteoliposomes through protease protection assays

    • Quantify protein:lipid ratios for optimal activity

  • Advanced Statistical Analysis:

    • Implement Maximum A Posteriori (MAP) estimation approaches for data analysis

    • Apply machine learning algorithms to distinguish signal from noise

    • Use the MAP enrichment metric to identify true positive signals in noisy datasets

    • Validate findings with multiple independent assay systems

For data analysis, the application of MAP estimation can be particularly valuable in distinguishing specific signal from background noise, similar to its application in cell-based selection datasets . This approach is especially useful when dealing with the inherently noisy data often generated in membrane protein assays.

To systematically evaluate assay conditions, researchers should design experiments using fractional factorial designs (FFD) that allow for efficient testing of multiple variables . This approach enables identification of optimal conditions while minimizing the number of experiments required, making it ideal for complex membrane protein systems like ArnF.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.