Recombinant Escherichia coli Probable acyltransferase yihG (yihG)

Shipped with Ice Packs
In Stock

Description

2.1. YihG as an SlPlsC4 Ortholog

Using the BLAST program with the SlPlsC4 amino acid sequence as a query, analysis of the E. coli genome revealed that E. coli YihG is an SlPlsC4 ortholog . The amino acid sequence of YihG shares 39.1% identity with that of SlPlsC4 . YihG contains highly conserved acyltransferase motifs I–III but does not contain a motif IV like SlPlsC4 . This suggests that YihG has a similar enzymatic activity to SlPlsC4 .

2.2. Complementation Assays

In vivo complementation assays using E. coli strain JC201, which carries a temperature-sensitive mutation in plsC, showed that cells expressing recombinant YihG grew well at 42 °C in the presence of 2% l-arabinose, but showed no or marginal growth in the presence of 0 to 1% l-arabinose . No complementation was observed in cells harboring the empty vector under the same conditions . This demonstrates that YihG, like PlsC, can act as an LPAAT in vivo .

2.3. Physiological Contribution of YihG to Cell Growth

Comparison of the growth rates of JC201 cells overexpressing YihG with JC201 cells overexpressing PlsC showed that cells overexpressing PlsC showed vigorous growth at 37 °C in the presence of both 0.5% and 1% l-arabinose . The growth rate of cells overexpressing YihG at 37 °C was much slower than that of cells overexpressing PlsC in the presence of 0.5% l-arabinose, but these strains grew similarly in the presence of 1% l-arabinose . These results indicated that YihG, expressed following l-arabinose induction, suppresses the growth defect of an E. coli plsC mutant at non-permissive temperatures in a quantity-dependent manner .

3.1. Modulation of Fatty Acyl Composition

Analysis of the fatty acyl composition of PLs from the yihG-deletion mutant (∆ yihG) revealed that endogenous YihG introduces the cis-vaccenoyl group into the sn-2 position of PLs . Loss of YihG did not affect cell growth or morphology, but ∆ yihG cells swam well in liquid medium in contrast to wild-type cells . Immunoblot analysis showed that FliC was highly expressed in ∆ yihG cells, and this phenotype was suppressed by expression of recombinant YihG in ∆ yihG cells . Transmission electron microscopy confirmed that the flagellar structure was observed only in ∆ yihG cells . These results suggest that YihG has specific functions related to flagellar formation through modulation of the fatty acyl composition of membrane PLs .

3.2. Involvement in Flagellar Formation and Swimming Motility

YihG has specific functions related to flagellar formation through modulation of the fatty acyl composition of membrane PLs . The yihG-deletion mutant (∆ yihG) swam well in liquid medium in contrast to wild-type cells, suggesting that YihG influences swimming motility .

YihG and Recombinant Protein Overexpression

Studies have been done using recombinant E. coli to improve protein yields . Transcriptome analysis has been used to study the adaptation of E. coli to recombinant protein overexpression . YihG may play a role in the adaptation of E. coli to recombinant protein overexpression, but more research is needed to confirm this .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
yihG; b3862; JW3834; Probable acyltransferase YihG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yihG
Target Protein Sequence
MANLLNKFIMTRILAAITLLLSIVLTILVTIFCSVPIIIAGIVKLLLPVPVIWRKVSRFC DFMMYCWCEGLAVLLHLNPHLQWEVHGLEGLSKKNWYLLICNHRSWADIVVLCVLFRKHI PMNKYFLKQQLAWVPFLGLACWSLDMPFMKRYSRAYLLRHPERRGKDVETTRRSCEKFRL HPTTIVNFVEGSRFTQEKHQQTHSTFQNLLPPKAAGIAMALNVLGKQFDKLLNVTLCYPD NNRQPFFDMLSGKLTRIVVHVDLQPIADELHGDYINDKSFKRHFQQWLNSLWQEKDRLLT SLMSSQRQNK
Uniprot No.

Target Background

Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YihG and what is its primary function in E. coli?

YihG is a lysophosphatidic acid acyltransferase (LPAAT) homolog in Escherichia coli that introduces fatty acyl groups into the sn-2 position of membrane phospholipids (PLs). Specifically, endogenous YihG introduces the cis-vaccenoyl group into the sn-2 position of PLs. Until recently, it was widely believed that E. coli possessed only one essential LPAAT homolog, PlsC, but research has confirmed that YihG functions as a second LPAAT with substrate specificity distinct from PlsC .

How does YihG differ from the well-characterized PlsC acyltransferase?

YihG and PlsC exhibit different substrate specificities in their acyltransferase activities:

AcyltransferasePosition SpecificityFatty Acid Preference at sn-2Fatty Acid Preference at sn-1
YihGsn-2 position14:0 and 18:1 (cis-vaccenoyl)18:1
PlsCsn-2 position16:1 and 16:016:0

While PlsC is essential for E. coli survival (deletion is lethal), YihG is non-essential for basic cellular functions but plays a specialized role in flagellar formation and motility regulation .

What phenotypic changes occur in yihG deletion mutants?

The deletion of yihG (ΔyihG) results in several observable phenotypic changes:

  • Enhanced swimming motility in liquid medium compared to wild-type cells

  • Increased expression of FliC (flagellin protein)

  • Presence of visible flagellar structures (absent in wild-type under the same conditions)

  • No significant effect on cell growth or morphology

These phenotypic changes indicate that YihG has specific functions related to flagellar formation through modulation of the fatty acyl composition of membrane phospholipids .

What methods can be used to confirm the LPAAT activity of recombinant YihG?

To confirm LPAAT activity of recombinant YihG, researchers should implement a multi-faceted approach:

  • In vivo complementation assays: Transform E. coli strain JC201 (carrying a temperature-sensitive mutation in plsC) with a plasmid expressing YihG under an inducible promoter (e.g., pBAD). Test growth at non-permissive temperatures (37°C and 42°C) with varying inducer concentrations. Successful complementation indicates functional LPAAT activity .

  • Analysis of phospholipid fatty acyl composition: Extract total lipids from cells expressing YihG or control cells, separate phospholipid classes by thin-layer chromatography, and analyze fatty acid composition by gas chromatography-mass spectrometry (GC-MS). Compare the fatty acid profiles at the sn-1 and sn-2 positions to determine specific acyltransferase activity patterns .

  • In vitro enzyme assays: Purify recombinant YihG and measure its ability to transfer acyl groups from acyl-CoA donors to lysophosphatidic acid acceptors. Monitor product formation using radiolabeled substrates or mass spectrometry .

How should researchers design experiments to study YihG's impact on bacterial motility?

When designing experiments to study YihG's impact on bacterial motility, researchers should implement a comprehensive experimental design:

  • Treatment design: Compare multiple strains (wild-type, ΔyihG, and ΔyihG complemented with recombinant YihG) under various environmental conditions that might affect motility (temperature, media composition, viscosity) .

  • Experimental design: Use a randomized complete block design (RCB) with at least four replicate blocks to control for environmental variability within the laboratory setting .

  • Response design: Implement multiple measurement methods for motility assessment:

    • Swimming motility assays on semi-solid agar plates (0.25-0.3% agar)

    • Video-tracking of individual cells in liquid media

    • Quantification of flagellar proteins (FliC) by immunoblot analysis

    • Direct visualization of flagellar structures by transmission electron microscopy

A proper description of this study would be: "Treatments consisted of three E. coli strains (wild-type, ΔyihG, and complemented ΔyihG) under two temperature conditions arranged in a 3×2 factorial treatment design. The experimental design was a randomized complete block with 4 blocks, and three independent measurements were taken from each experimental unit."

What NIH guidelines apply to recombinant E. coli strains expressing YihG?

Research involving recombinant YihG in E. coli K-12 or K-12 derivatives generally falls under exempt status according to NIH Guidelines, provided specific conditions are met:

  • The host does not contain conjugation-proficient plasmids or generalized transducing phages, OR

  • Lambda or lambdoid or Ff bacteriophages or non-conjugative plasmids are used as vectors .

  • Experiments involving DNA from Risk Groups 3 or 4 organisms

  • Large-scale experiments (more than 10 liters of culture)

  • Experiments involving toxin molecule genes coding for vertebrate toxins

  • Experiments described in Section III-B of the NIH Guidelines .

For exempt laboratory experiments with recombinant YihG in K-12 strains, Biosafety Level-1 (BSL-1) physical containment conditions are recommended .

How do laboratory safety requirements differ when working with recombinant YihG in pathogenic versus non-pathogenic E. coli strains?

Safety requirements differ significantly based on the E. coli strain used for YihG expression:

E. coli Strain TypeSafety LevelRequirementsRisk Assessment
K-12 derivatives (DH5α, BL21)BSL-1Basic laboratory practices, minimal PPEMinimal risk, exempt from IBC review if conditions met
Pathogenic strains (O157:H7)BSL-2Biological safety cabinet, enhanced PPE, limited accessHigher risk, requires IBC review and approval

When working with pathogenic strains, researchers must consider that some produce toxins that damage the intestinal lining. For example, E. coli O157:H7 produces a powerful toxin that can cause severe illness, including bloody diarrhea and potential kidney failure . Additional containment measures would be required, and experiments would not be exempt from NIH Guidelines or IBC review .

How can researchers investigate the molecular mechanism of YihG's influence on flagellar formation?

To investigate the molecular mechanism of YihG's influence on flagellar formation, researchers should implement a multi-disciplinary approach:

  • Transcriptomics analysis: Compare gene expression profiles between wild-type and ΔyihG cells using RNA-seq to identify differentially expressed genes involved in flagellar biosynthesis and regulation. Focus on class I (flhDC), class II (fliA), and class III (fliC) flagellar genes.

  • Membrane composition analysis:

    • Conduct lipidomics analysis to characterize membrane phospholipid compositions in wild-type versus ΔyihG strains

    • Analyze membrane fluidity using fluorescence anisotropy with DPH probe

    • Examine membrane microdomain formation using super-resolution microscopy

  • Protein-lipid interaction studies:

    • Use fluorescence resonance energy transfer (FRET) to investigate interactions between flagellar proteins and specific membrane lipids

    • Conduct pull-down assays with purified flagellar proteins to identify lipid binding partners

  • Site-directed mutagenesis:

    • Create point mutations in YihG's catalytic domain to identify residues critical for substrate specificity

    • Express mutant YihG proteins in ΔyihG cells and assess their ability to restore wild-type phenotypes

The research question should be clearly defined: "How does YihG-mediated alteration of membrane phospholipid composition affect the assembly and regulation of flagellar structures in E. coli?"

What approaches can be used to resolve contradictory data regarding YihG function?

When confronted with contradictory data regarding YihG function, researchers should implement a systematic troubleshooting approach:

  • Strain background verification: Confirm the genetic background of all strains used, as suppressor mutations or strain-specific genetic factors may influence YihG phenotypes. Sequence the entire genome of key strains to identify potential modifiers.

  • Experimental design refinement:

    • Implement a randomized complete block design to control for environmental variables

    • Include positive and negative controls in each experimental block

    • Increase the number of biological replicates (minimum n=4) to improve statistical power

  • Multiple methodological approaches:

    • If contradictions exist between genetic and biochemical data, employ both in vivo and in vitro approaches

    • Use different expression systems with varying levels of YihG expression

    • Compare results across multiple growth conditions and media formulations

  • Data triangulation: Use at least three independent methods to measure each key parameter. For example, to assess flagellar formation:

    • Transmission electron microscopy

    • Immunoblot analysis of flagellar proteins

    • Functional motility assays

    • Flagellar gene expression analysis

A specific example would be addressing contradictory findings about YihG's role in motility by examining the effect of growth phase, temperature, and media composition on the ΔyihG phenotype, as these variables might explain apparently contradictory observations from different laboratories .

What statistical approaches are most appropriate for analyzing YihG's effects on membrane composition?

When analyzing YihG's effects on membrane phospholipid composition, researchers should apply the following statistical approaches:

  • Multivariate analysis: Since membrane composition involves multiple phospholipid species and fatty acid combinations, use principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) to identify patterns in the complex lipid profiles of wild-type versus ΔyihG strains.

  • Mixed-effects models: When analyzing data from experiments with a randomized complete block design, use mixed-effects models that include both fixed effects (strain, temperature, media composition) and random effects (block, technical replication) .

  • Multiple comparison corrections: When testing differences in multiple lipid species simultaneously, apply false discovery rate (FDR) corrections (such as Benjamini-Hochberg procedure) to control for Type I errors resulting from multiple hypothesis testing.

  • Power analysis: Before conducting experiments, perform power analysis to determine the required sample size for detecting biologically meaningful differences in phospholipid composition. For a typical lipidomics experiment comparing wild-type and ΔyihG strains, aim to detect a 20% difference in key phospholipid species with 80% power at α=0.05 .

The statistical analysis should be planned during the experimental design phase rather than after data collection to ensure proper controls and sufficient replication .

How can researchers distinguish between direct and indirect effects of YihG on cellular phenotypes?

To distinguish between direct and indirect effects of YihG on cellular phenotypes, researchers should implement a systematic causal analysis approach:

  • Genetic complementation analysis:

    • Express wild-type YihG in ΔyihG cells and assess phenotype rescue

    • Express catalytically inactive YihG mutants and compare phenotypes

    • Create chimeric proteins between YihG and PlsC to identify domain-specific functions

  • Metabolic labeling experiments:

    • Use pulse-chase experiments with radiolabeled or stable isotope-labeled fatty acids to track the dynamics of membrane phospholipid remodeling

    • Compare the incorporation rates of labeled fatty acids between wild-type and ΔyihG strains

  • Temporal analysis:

    • Track changes in membrane composition, flagellar gene expression, and motility over time after induction of YihG expression in a ΔyihG background

    • Establish the sequence of events to determine which changes occur first

  • Synthetic biology approaches:

    • Modify membrane composition independently of YihG (e.g., by expressing heterologous acyltransferases or by supplementation with specific fatty acids)

    • Determine if these modifications can mimic or suppress the ΔyihG phenotype

Implement a mediation analysis framework to statistically evaluate whether the effect of YihG on flagellar formation is mediated through changes in specific phospholipid species. This approach requires quantifying both the direct pathway (YihG → flagellar formation) and the indirect pathway (YihG → phospholipid composition → flagellar formation) .

What are the most promising avenues for extending our understanding of YihG's role in bacterial physiology?

The most promising research directions for extending our understanding of YihG include:

  • Systems biology integration: Develop comprehensive models integrating transcriptomics, proteomics, and lipidomics data to understand how YihG-mediated changes in membrane composition affect multiple cellular processes beyond flagellar formation.

  • Ecological significance: Investigate the ecological advantage of YihG regulation under different environmental conditions. For example, determine whether YihG-mediated suppression of flagellar formation provides a fitness advantage under specific environmental stresses or in biofilm formation.

  • Structural biology approaches: Determine the crystal structure of YihG to understand its substrate specificity and catalytic mechanism. Compare this with the structure of PlsC to identify key differences that explain their distinct substrate preferences.

  • Evolutionary analysis: Conduct comparative genomics across diverse bacterial species to understand the evolutionary history of YihG and identify potential functional homologs in other bacteria. This could reveal whether the dual LPAAT system is unique to E. coli or represents a more widely conserved regulatory mechanism .

  • Potential as antimicrobial target: Evaluate whether YihG represents a potential target for novel antimicrobial compounds that could selectively disrupt membrane homeostasis in pathogenic bacteria while sparing commensal microbiota.

These research directions would significantly expand our understanding of YihG beyond its current characterized role in flagellar regulation .

What methodological innovations would advance research on membrane phospholipid acyltransferases like YihG?

Advancing research on membrane phospholipid acyltransferases like YihG would benefit from the following methodological innovations:

  • Advanced imaging techniques:

    • Develop live-cell imaging methods to visualize phospholipid dynamics in bacterial membranes using fluorescent phospholipid analogs

    • Apply super-resolution microscopy (STORM, PALM) to examine the spatial organization of YihG and its potential co-localization with flagellar assembly complexes

  • High-throughput screening platforms:

    • Develop fluorescence-based or growth-based assays suitable for screening compound libraries for modulators of YihG activity

    • Create reporter systems that reflect YihG activity in vivo for use in genetic screens

  • Synthetic biology tools:

    • Design tunable expression systems for precise control of YihG levels in vivo

    • Create orthogonal acyltransferase systems with engineered substrate specificities

  • Computational methods:

    • Develop machine learning algorithms to predict the impact of specific membrane phospholipid compositions on protein complex assembly

    • Create molecular dynamics simulations to model how changes in membrane composition affect membrane properties and protein-membrane interactions

  • Single-cell analysis:

    • Apply microfluidic systems combined with high-resolution microscopy to study cell-to-cell variability in YihG expression and its consequences for flagellar formation

    • Develop single-cell lipidomics approaches to understand heterogeneity in membrane composition

These methodological innovations would significantly enhance our ability to study not only YihG but also other membrane-modifying enzymes and their roles in bacterial physiology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.