Recombinant Escherichia coli Probable D,D-dipeptide transport system permease protein ddpB (ddpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in D,D-Dipeptide Transport

ddpB is integral to the ATP-binding cassette (ABC) transporter complex DdpABCDF, which imports D,D-dipeptides into bacterial cells . Mechanistically:

  • Permease Activity: ddpB and ddpC form the transmembrane channel, enabling substrate translocation .

  • Energy Coupling: ATP hydrolysis by ddpD/ddpF drives transport .

  • Substrate Specificity: Preferentially recognizes D,D-configuration dipeptides, distinguishing it from L,D-transport systems .

Structural studies of homologous proteins (e.g., Salmonella oligopeptide-binding protein) suggest a conserved backbone recognition mechanism, accommodating diverse side chains via flexible binding pockets .

Interaction Network and Complex Formation

STRING database analysis identifies ddpB’s functional partners in E. coli :

Interacting ProteinRole in DdpABCDF ComplexAssociation Score
ddpCCo-permease; substrate translocation0.998
ddpD/ddpFATP hydrolysis for transport energy0.995–0.996
ddpAPeriplasmic substrate binding0.995
gsiD/nikCGlutathione/nickel transport homology0.926–0.929

Recombinant Production and Applications

Recombinant ddpB is produced in E. coli for biochemical studies:

  • Cloning: Full-length ddpB gene (locus b1486) fused to a His tag .

  • Applications:

    • SDS-PAGE analysis of membrane protein expression .

    • Structural studies (e.g., crystallization, SAXS) to resolve transport mechanisms .

    • Functional assays to probe substrate specificity and inhibitor screening .

Research Implications

  • Antimicrobial Targeting: ABC transporters like DdpABCDF are potential targets for disrupting nutrient uptake in pathogenic bacteria .

  • Evolutionary Insights: Homology with Borrelia burgdorferi DbpA/DbpB underscores conserved roles in bacterial virulence and host adaptation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ddpB; yddR; b1486; JW1481; Probable D,D-dipeptide transport system permease protein DdpB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ddpB
Target Protein Sequence
MTFWSILRQRCWGLVLVVAGVCVITFIISHLIPGDPARLLAGDRASDAIVENIRQQLGLD QPLYVQFYRYVSDLFHGDLGTSIRTGRPVLEELRIFFPATLELAFGALLLALLIGIPLGI LSAVWRNRWLDHLVRIMAITGISTPAFWLGLGVIVLFYGHLQILPGGGRLDDWLDPPTHV TGFYLLDALLEGNGEVFFNALQHLILPALTLAFVHLGIVARQIRSAMLEQLSEDYIRTAR ASGLPGWYIVLCYALPNALIPSITVLGLALGDLLYGAVLTETVFAWPGMGAWVVTSIQAL DFPAVMGFAVVVSFAYVLVNLVVDLLYLWIDPRIGRGGGE
Uniprot No.

Target Background

Function

DdpB is a component of the ABC transporter complex DdpABCDF in Escherichia coli, likely involved in D,D-dipeptide transport. It is believed to be responsible for substrate translocation across the membrane.

Database Links
Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ddpB protein in Escherichia coli and how does it function?

The ddpB protein in E. coli functions as a permease component within an ABC (ATP-binding cassette) transporter complex dedicated to D,D-dipeptide transport across the bacterial membrane. Similar to the DppBCDF system observed in Pseudomonas aeruginosa, the ddpB forms part of a multicomponent transport machinery responsible for the recognition and translocation of specific peptide substrates . As an integral membrane protein, ddpB forms a channel structure that enables the passage of dipeptides from the periplasmic space into the cytoplasm, working in concert with ATP-binding proteins that drive the energetics of transport.

How does the ddpB transport system compare to other peptide transport systems in bacteria?

The ddpB system shows significant functional similarities to other bacterial peptide transporters while maintaining unique substrate preferences. The P. aeruginosa DppBCDF system provides a useful comparison model, where the transporter comprises multiple components including the membrane-spanning permease proteins (DppB and DppC) and the nucleotide-binding domains (DppD and DppF) . While E. coli's ddpB system is specialized for D,D-dipeptides, these systems generally differ in their substrate recognition patterns based on their associated substrate-binding proteins (SBPs). The P. aeruginosa system demonstrates remarkable flexibility through its five orthologous SBPs (DppA1–A5), which collectively broaden substrate specificity compared to E. coli's single DppA protein .

What expression vectors are most effective for recombinant ddpB production?

Based on research with membrane proteins in E. coli, vectors with moderate copy numbers generally provide superior results for ddpB expression compared to high-copy variants. Data indicates that vectors with p15A origin (approximately 10 copies/cell) often yield higher functional protein levels than those with pMB1-derived origins (500-700 copies/cell) . Promoter selection significantly impacts expression outcomes, with moderate-strength promoters like Ptrc and Ptac generally providing better balance between expression level and proper folding than stronger promoters like PT7 .

Vector ComponentOptimal CharacteristicsRationale
Origin of Replicationp15A (10 copies/cell)Reduces metabolic burden; improves protein folding
PromoterPtrc or Ptac (moderate strength)Balances expression level with folding capacity
Carbon SourceGlycerol preferred over glucoseImproves expression yields in wild-type E. coli
Host StrainE. coli BL21 or derivativesReduced protease activity improves yield

How can researchers overcome inclusion body formation when expressing recombinant ddpB?

Membrane proteins like ddpB frequently form inclusion bodies during recombinant expression. Research data shows that promoter strength significantly affects inclusion body formation, with weaker promoters like PBAD demonstrating lower insoluble protein fractions compared to stronger promoters . Even with optimized expression constructs, cultures containing plasmids with the strongest promoters (Ptrc, Ptac) showed approximately equal percentages of soluble and insoluble protein . Methodological approaches to minimize inclusion bodies include:

  • Lowering cultivation temperature to 16-25°C during induction

  • Using glycerol rather than glucose as carbon source

  • Employing lower IPTG concentrations for induction (0.01-0.05 mM)

  • Co-expressing molecular chaperones to assist protein folding

  • Utilizing specialized E. coli strains designed for membrane protein expression

What purification strategies are most effective for obtaining functional ddpB protein?

Purification of functional ddpB requires specialized approaches due to its membrane-embedded nature. The methodology should include:

  • Gentle cell lysis methods to preserve membrane integrity

  • Selective membrane solubilization using mild detergents (DDM, LDAO, or CHAPS)

  • Affinity chromatography using engineered tags (polyhistidine tags are commonly employed)

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Detergent exchange during purification if required for downstream applications

Maintaining detergent concentrations above the critical micelle concentration throughout purification is essential to prevent protein aggregation. The final purified protein should be validated for functionality through transport assays or substrate binding analysis.

How can substrate specificity of ddpB be experimentally determined?

Determining the substrate specificity of ddpB requires systematic transport or binding assays. High-throughput methods similar to those employed for DppBCDF characterization can be adapted, using phenotype MicroArray technology to screen hundreds of dipeptides with various side-chains . This approach allows researchers to determine the substrate profile of the dipeptide permease. The substrate spectrum can be elucidated through complementation studies, where the transport of specific dipeptides is monitored in systems expressing different components of the transporter.

Research with the P. aeruginosa system revealed that some dipeptides were utilized with different affinity depending on which substrate-binding protein was present, with DppA2 showing the highest flexibility in substrate recognition and DppA2 and DppA4 demonstrating higher tendency to utilize tripeptides . Similar methodological approaches could be applied to investigate ddpB specificity.

What analytical techniques best characterize ddpB-substrate interactions at the molecular level?

Characterizing ddpB-substrate interactions requires sophisticated biophysical techniques including:

  • Surface plasmon resonance (SPR) or biolayer interferometry for real-time binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic binding parameters

  • Fluorescence-based assays using labeled substrates to track binding and transport

  • Structural analyses through X-ray crystallography or cryo-electron microscopy

  • Site-directed mutagenesis of predicted binding residues coupled with functional assays

These approaches provide complementary information about binding affinity, specificity, thermodynamics, and structural basis of substrate recognition. Competition assays with labeled and unlabeled substrates can further elucidate binding preferences and relative affinities for different dipeptides.

How do post-translational modifications affect ddpB function and how can these be studied?

Though bacterial proteins typically undergo fewer post-translational modifications than eukaryotic counterparts, modifications like phosphorylation can critically regulate ddpB function. Methodological approaches include:

  • Phosphoproteomic analyses using mass spectrometry with titanium dioxide enrichment

  • Site-directed mutagenesis of potential modification sites followed by functional analysis

  • In vitro modification assays using purified kinases or other modification enzymes

  • Time-course studies examining modification patterns in response to environmental signals

For comprehensive characterization, researchers should combine detection of modifications with functional transport assays to correlate biochemical changes with physiological outcomes.

What methodologies effectively measure ddpB transport activity?

Quantitative assessment of ddpB transport activity requires multiple complementary approaches:

  • Whole-cell uptake assays using radiolabeled or fluorescently tagged dipeptide substrates

  • Liposome reconstitution experiments with purified components of the transport system

  • Membrane vesicle transport assays measuring substrate accumulation

  • ATP hydrolysis assays coupled to transport measurements to assess energetic coupling

  • Growth complementation studies using ddpB-deficient strains and selective media

For kinetic analysis, researchers should perform concentration-dependent transport measurements to determine parameters such as Km and Vmax, providing insights into transport efficiency and substrate affinity.

How can researchers investigate the structural dynamics of ddpB during the transport cycle?

Understanding the structural transitions of ddpB during substrate transport requires specialized biophysical approaches:

  • Cryo-electron microscopy to capture different conformational states with appropriate substrates

  • Site-directed spin labeling combined with electron paramagnetic resonance spectroscopy

  • Hydrogen-deuterium exchange mass spectrometry to identify regions undergoing conformational changes

  • Molecular dynamics simulations based on structural models to predict conformational intermediates

  • Distance measurements between engineered fluorophores or spin labels to track domain movements

These complementary techniques can reveal how ddpB changes conformation during substrate binding, translocation, and release phases of the transport cycle.

How does the E. coli ddpB system compare functionally with the P. aeruginosa DppBCDF system?

Comparative analysis reveals important functional differences between these transport systems:

  • Substrate-binding protein diversity: E. coli typically employs a single substrate-binding protein, while P. aeruginosa utilizes five orthologous SBPs (DppA1–A5) that expand substrate recognition capacity

  • Substrate specificity: While ddpB is specialized for D,D-dipeptides, the P. aeruginosa system handles a broader range of di/tripeptides, with some SBPs showing preferences for specific substrate types

  • Functional flexibility: Research demonstrates that DppA2 in P. aeruginosa shows the highest substrate recognition flexibility, while DppA2 and DppA4 have higher tendency to utilize tripeptides

  • Specialized transport: The P. aeruginosa system can transport toxic tripeptides like phaseolotoxin, with specific SBPs (particularly DppA3) responsible for toxin delivery to the permease

These comparative insights highlight the evolutionary adaptations in peptide transport systems across different bacterial species.

What can recombinant expression studies of ddpB teach us about optimizing membrane protein production?

Recombinant expression studies with membrane proteins like ddpB provide valuable lessons for protein production optimization:

  • Vector design impact: High copy number vectors have been associated with lower protein production than medium and low copy plasmids, with p15A origin vectors (10 copies/cell) often outperforming high-copy pMB1-derived plasmids (500-700 copies/cell)

  • Promoter-copy number interaction: Strong promoters combined with high-copy plasmids create metabolic mismatch, triggering decreased production

  • Carbon source influence: Studies show that glycerol as carbon source often yields higher expression than glucose, particularly in wild-type E. coli hosts

  • Solubility considerations: The proportion of soluble versus insoluble (inclusion body) protein varies significantly based on expression conditions, with weaker promoters like PBAD showing lower insoluble fractions

  • Metabolic burden assessment: The presence of expression plasmids causes physiological consequences including altered growth rates and differential expression of essential metabolic enzymes

These insights can guide optimization strategies for producing other challenging membrane proteins beyond ddpB.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.