Recombinant Escherichia coli Probable diguanylate cyclase AdrA (adrA)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Bacterial Physiology

AdrA regulates cellular processes by modulating c-di-GMP levels, which act as a global second messenger. Key findings across bacterial species include:

In Pseudomonas fluorescens

  • Biofilm Formation: AdrA overexpression reduces motility and enhances surface attachment via c-di-GMP accumulation .

    • adrA mutants show increased swimming motility and reduced biofilm formation .

    • Acts upstream of SadB, a c-di-GMP receptor with higher affinity than FleQ .

In Salmonella enterica

  • Cellulose Production: AdrA activates cellulose synthase BcsA via c-di-GMP, promoting biofilm formation .

    • adrA mutants exhibit reduced cellulose synthesis and curli protein CsgA levels .

    • Contributes to desiccation tolerance on plant surfaces via colanic acid regulation .

In Escherichia coli

While native AdrA (YaiC) is less studied, recombinant AdrA retains functional activity:

  • Catalytic Activity: Ectopic expression in E. coli DH5α reduces swimming motility, confirming DGC activity .

  • Relevance to Pathogenicity: Homologs like DncV (cGAMP synthase) regulate biofilm formation and motility, suggesting conserved pathways .

Recombinant Protein Production

The recombinant AdrA protein (Cat. No. RFL31478EF) is optimized for laboratory use :

SpecificationDetail
Expression SystemE. coli (BL21(DE3) or similar)
PurificationNickel affinity chromatography (His-tag)
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water with 5–50% glycerol (recommended)

Experimental Data from Functional Studies

  • c-di-GMP Measurement: adrA mutants in Pseudomonas show ~70% reduction in intracellular c-di-GMP compared to wild-type .

  • Motility Assays: Overexpression of AdrA in Pseudomonas or E. coli reduces swimming speed by 2–3 fold .

  • Biofilm Formation: AdrA-dependent c-di-GMP accumulation correlates with increased cellulose/curli production in Salmonella .

Comparative Analysis of AdrA in Bacterial Pathways

Table 2: AdrA Function Across Species

SpeciesPrimary RoleKey TargetsRegulatory Partners
PseudomonasFlagella biosynthesis regulationSadB, FleQAmrZ, GacS
SalmonellaCellulose production, desiccationBcsA, CsgDCsgD, WcaJ (colanic acid)
E. coli (YaiC)Biofilm formation, motility suppressionNot fully characterizedDncV (cGAMP), SadR

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
dgcC; adrA; yaiC; b0385; JW0376; Probable diguanylate cyclase DgcC; DGC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
dgcC
Target Protein Sequence
MFPKIMNDENFFKKAAAHGEEPPLTPQNEHQRSGLRFARRVRLPRAVGLAGMFLPIASTL VSHPPPGWWWLVLVGWAFVWPHLAWQIASRAVDPLSREIYNLKTDAVLAGMWVGVMGVNV LPSTAMLMIMCLNLMGAGGPRLFVAGLVLMVVSCLVTLELTGITVSFNSAPLEWWLSLPI IVIYPLLFGWVSYQTATKLAEHKRRLQVMSTRDGMTGVYNRRHWETMLRNEFDNCRRHNR DATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRGSDVIGRFGGDEFAVIMSGT PAESAITAMLRVHEGLNTLRLPNTPQVTLRISVGVAPLNPQMSHYREWLKSADLALYKAK KAGRNRTEVAA
Uniprot No.

Target Background

Function
AdrA is a probable diguanylate cyclase. Its expression is dependent on DgcM, being the last member of a cascade of expressed proteins. DgcC production triggers cellulose biosynthesis in certain E.coli isolates but not in K12 strains. Cyclic-di-GMP, a second messenger, regulates cell surface-associated characteristics in bacteria.
Gene References Into Functions
  1. Research suggests that one mechanism by which deletion of the Pst system reduces type 1 fimbriae expression involves PhoBR-mediated activation of yaiC. This, in turn, increases c-di-GMP accumulation, represses the fim operon, and consequently, attenuates virulence in the mouse urinary tract infection model. PMID: 28924030
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is diguanylate cyclase AdrA and what are its alternative nomenclatures in scientific literature?

Diguanylate cyclase AdrA (also known as DgcC or YaiC) is a membrane-associated enzyme in Escherichia coli responsible for producing cyclic di-GMP, a bacterial second messenger that regulates various cellular processes. The gene encoding this protein is designated as dgcC, with synonyms including adrA, yaiC, b0385, and JW0376 . The UniProt ID for this protein is P0AAP1, and it is classified as a "probable diguanylate cyclase" within the protein database nomenclature system .

This enzyme plays a significant role in bacterial signaling networks, particularly those involved in biofilm formation, motility regulation, and environmental adaptation. In comparative genomics studies, AdrA homologs have been identified across multiple bacterial species including Salmonella, Vibrio, Yersinia, and Pseudomonas . These homologs maintain conserved functional domains while exhibiting species-specific regulatory mechanisms.

How does AdrA function in bacterial signaling pathways?

AdrA functions as a diguanylate cyclase that synthesizes the bacterial second messenger cyclic di-GMP (c-di-GMP) from two GTP molecules. This enzymatic activity resides within the C-terminal GGDEF domain of the protein . The production of c-di-GMP by AdrA influences several critical bacterial processes, establishing a molecular link between environmental sensing and physiological responses.

In Salmonella, the AdrA homolog has been shown to induce biofilm formation by increasing cellulose production through activation of the bacterial cellulose synthesis (bcs) operon . The expression of adrA itself is regulated by the curli biosynthesis regulator CsgD, placing AdrA within a hierarchical regulatory network .

Experimental studies in Pseudomonas fluorescens F113 have demonstrated that AdrA acts upstream of SadB in signaling pathways, creating a connection between environmental sensing and downstream effectors . Mutation studies have revealed that an adrA mutant in P. fluorescens F113 exhibits increased motility and reduced surface attachment capabilities, underscoring AdrA's role in regulating bacterial movement and adherence behaviors .

What are the optimal expression systems and conditions for producing recombinant AdrA protein?

The successful expression of recombinant AdrA protein requires careful consideration of expression systems and conditions to maximize yield while maintaining protein functionality. Based on current research data, E. coli remains the preferred expression system for AdrA due to its well-established protocols, rapid growth, and cost-effectiveness .

For optimal expression, the full-length AdrA protein (371 amino acids) can be produced with an N-terminal His-tag fusion to facilitate purification . The expression construct should be designed with attention to codon optimization, as the nucleotide sequence immediately following the start codon can significantly influence translation efficiency . When designing expression vectors, researchers should consider using the T7 promoter system, which offers strong induction capabilities, though careful titration of inducer concentration is necessary to avoid toxicity effects .

Temperature modulation is a critical factor for optimal expression. While standard growth at 37°C maximizes cell growth rate, post-induction temperature reduction to 18-25°C often improves the solubility of membrane-associated proteins like AdrA by slowing down protein synthesis and allowing proper folding and membrane insertion .

How can N-terminal sequence modifications enhance AdrA expression yield and solubility?

Recent research has demonstrated that modifications to the N-terminal coding sequence can significantly improve recombinant protein production in E. coli . For membrane proteins like AdrA, N-terminal engineering is particularly valuable for enhancing expression yield and proper membrane integration.

A directed evolution approach using fluorescence-activated cell sorting (FACS) has proven effective for optimizing N-terminal sequences . This methodology involves:

  • Creating DNA libraries with diversified sequences coding for the N-termini of the target protein

  • Fusing a GFP reporter to the C-terminus of the construct

  • Using FACS to identify and isolate cells with enhanced fluorescence, indicating higher expression levels

  • Sequencing and characterizing the selected variants to identify beneficial N-terminal modifications

This systematic approach has demonstrated impressive results, with increases in soluble recombinant protein yields up to 30-fold for various constructs . For AdrA specifically, optimizing the first 10-15 codons following the start codon could potentially address expression challenges related to translation initiation efficiency and mRNA secondary structure formation.

What purification strategies yield the highest purity and activity of recombinant AdrA?

Purification of recombinant AdrA presents challenges due to its membrane-associated nature. A systematic purification workflow is essential to obtain high-purity, functional protein. The recommended protocol includes:

  • Cell Lysis and Membrane Fraction Isolation:

    • Gentle cell disruption using sonication or French press

    • Differential centrifugation to separate membrane fractions

    • Solubilization of membrane proteins using appropriate detergents (e.g., DDM, LDAO)

  • Affinity Chromatography:

    • Immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag

    • Recommended buffer: Tris/PBS-based buffer, pH 8.0 with appropriate detergent

  • Storage and Handling:

    • Store purified protein at -20°C/-80°C

    • Add 6% trehalose as a stabilizing agent

    • Include 5-50% glycerol in the final formulation

    • Avoid repeated freeze-thaw cycles

For reconstitution of lyophilized protein, it is recommended to briefly centrifuge the vial before opening, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL . The addition of glycerol (final concentration 5-50%) is advised for long-term storage, with 50% being the default recommendation .

What assays are available for measuring AdrA diguanylate cyclase activity?

Characterizing the enzymatic activity of AdrA is essential for understanding its function in bacterial signaling pathways. Several methodological approaches can be employed to measure diguanylate cyclase activity:

  • Direct Measurement of c-di-GMP Production:

    • High-Performance Liquid Chromatography (HPLC) separation coupled with UV detection

    • Liquid Chromatography-Mass Spectrometry (LC-MS) for highly sensitive quantification

    • Radiolabeled GTP incorporation assays using [α-32P]-GTP as substrate

  • Indirect Phenotypic Assays:

    • Biofilm formation quantification using crystal violet staining

    • Cellulose production assessment using Congo red binding

    • Motility assays on semi-solid agar plates to assess flagellar function

  • Reporter-Based Systems:

    • c-di-GMP-responsive promoters fused to reporter genes (GFP, luciferase)

    • RNA-based fluorescent biosensors that change conformation upon c-di-GMP binding

When overexpressed in bacterial systems such as E. coli DH5α and P. fluorescens F113, AdrA demonstrates measurable diguanylate cyclase activity that can be detected through these assays . These methodologies provide complementary approaches for evaluating both the enzymatic capacity of the protein and its downstream physiological effects.

How does the MASE2 domain in AdrA facilitate environmental sensing?

The MASE2 (Membrane-Associated Sensor 2) domain in AdrA represents a critical component for environmental signal perception. This N-terminal domain contains four predicted transmembrane helices that anchor the protein to the cytoplasmic membrane, forming a receptor structure for environmental cues . Current research suggests several mechanisms through which the MASE2 domain may function:

  • Direct Signal Perception:

    • Recognition of small molecules or ions in the extracellular environment

    • Potential sensing of membrane properties (fluidity, tension, curvature)

    • Interaction with other membrane proteins or complexes

  • Conformational Signal Transduction:

    • Transmission of detected signals through conformational changes

    • Allosteric regulation of the C-terminal GGDEF domain's catalytic activity

    • Potential dimerization or oligomerization in response to signals

  • Regulatory Mechanisms:

    • Integration of multiple environmental inputs

    • Modulation of baseline catalytic activity through inhibitory or stimulatory effects

Despite recent advances, the specific signals detected by the MASE2 domain remain largely uncharacterized. Further research using techniques such as site-directed mutagenesis, chimeric domain swapping, and structural biology approaches will be necessary to fully elucidate the sensing mechanism of this important domain.

What is the relationship between AdrA activity and biofilm formation?

AdrA plays a pivotal role in regulating biofilm formation through its production of c-di-GMP, which serves as a key second messenger in the transition between motile and sessile bacterial lifestyles. The relationship between AdrA activity and biofilm formation is multifaceted:

In Salmonella, AdrA induces biofilm formation by increasing cellulose production through activation of the bacterial cellulose synthesis (bcs) operon . This process involves the following mechanistic steps:

  • Expression of adrA is activated by the curli biosynthesis regulator CsgD

  • AdrA synthesizes c-di-GMP through its diguanylate cyclase activity

  • Elevated c-di-GMP levels stimulate cellulose synthase activity

  • Increased cellulose production contributes to extracellular matrix formation

  • The extracellular matrix promotes surface adhesion, cellular aggregation, and environmental persistence

Research in P. fluorescens F113 has demonstrated that an adrA mutant shows reduced attachment to surfaces, confirming the conserved role of AdrA in biofilm development across different bacterial species . Furthermore, epistasis analysis has revealed that AdrA acts upstream of SadB in signaling pathways, creating a connection between environmental sensing and downstream effectors involved in biofilm formation .

What strategies can optimize membrane protein solubility when expressing recombinant AdrA?

The membrane-associated nature of AdrA presents significant challenges for achieving high yields of correctly folded, functional protein. Advanced strategies to enhance membrane protein solubility include:

  • Expression System Optimization:

    • Use of specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3))

    • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to facilitate proper folding

    • Controlled expression using tunable promoter systems to prevent overwhelming the membrane insertion machinery

  • Fusion Tag Approaches:

    • N-terminal fusion with solubility-enhancing partners (MBP, TrxA, SUMO)

    • Addition of signal sequences to direct proper membrane targeting

    • Incorporation of stabilizing domains that enhance folding efficiency

  • Expression Condition Optimization:

    • Systematic design of experiments (DoE) approach to identify optimal parameters

    • Temperature reduction post-induction (18-25°C) to slow synthesis rate

    • Media supplementation with specific membrane components or osmolytes

  • Directed Evolution Strategies:

    • FACS-based selection of N-terminal coding variants for enhanced expression

    • Random mutagenesis followed by screening for improved solubility

    • Computational design of stabilizing mutations based on homology modeling

A systematic experimental design methodology has been shown to achieve high levels (250 mg/L) of soluble recombinant protein expression in E. coli , and similar approaches could be adapted for membrane proteins like AdrA.

How can researchers address the metabolic burden associated with high-level expression of AdrA?

High-level expression of recombinant proteins like AdrA can impose significant metabolic burden on host cells, leading to reduced growth, plasmid instability, and decreased protein yield. Several strategies can mitigate these challenges:

  • Translational Control Optimization:

    • Fine-tuning of inducer concentration (IPTG < 0.1 mM) to reduce toxicity

    • Use of weaker promoters or ribosome binding sites to moderate expression levels

    • Implementation of auto-induction systems for gradual protein production

  • Resource Allocation Management:

    • Co-expression of limiting factors (tRNAs, chaperones) to alleviate bottlenecks

    • Metabolic engineering to enhance precursor availability

    • Growth medium optimization to support both biomass and protein production

  • Genetic Stability Considerations:

    • Selection of appropriate antibiotic markers and concentrations

    • Use of chromosomal integration for stable expression

    • Implementation of post-segregational killing systems to maintain plasmids

Recent research has revealed that excessive amounts of exogenous mRNA may outcompete endogenous mRNA for limited ribosomes, impairing the synthesis of host proteins essential for cell viability . This competition can lead to selective pressure favoring mutations that reduce or impair T7 RNA polymerase activity, resulting in decreased recombinant protein production . These findings underscore the importance of carefully balancing expression levels to maintain host cell viability while achieving adequate protein yields.

What are the current challenges and contradictions in research regarding AdrA function?

Despite significant advances in understanding AdrA function, several challenges and contradictions remain in the current research landscape:

  • Signal Specificity Uncertainty:

    • The specific environmental signals detected by the MASE2 domain remain largely unidentified

    • Different bacterial species may utilize AdrA homologs to respond to distinct environmental cues

    • The integration of multiple signals into coherent c-di-GMP production is poorly understood

  • Regulatory Network Complexity:

    • Bacteria often possess multiple diguanylate cyclases with potentially overlapping functions

    • The spatial and temporal coordination of different c-di-GMP sources remains unclear

    • Contradictory results regarding the primacy of different diguanylate cyclases in specific processes

  • Methodological Limitations:

    • Challenges in purifying sufficient quantities of functional membrane proteins

    • Limitations in directly measuring c-di-GMP production in living cells with high spatial resolution

    • Difficulties in reconstituting membrane protein function in vitro

  • Expression System Contradictions:

    • Despite the reported toxicity of high IPTG concentrations (> 0.1 mM), many labs routinely use higher concentrations successfully

    • Some research indicates that recombinant protein yields differ across several logs, suggesting factors beyond mRNA abundance affect expression

    • The relative importance of N-terminal sequence optimization versus other factors in improving expression remains debated

These contradictions highlight the need for more systematic experimental approaches and the potential value of emerging artificial intelligence tools in clarifying the complex relationships between expression conditions, host metabolism, and recombinant protein production .

How can site-directed mutagenesis be used to study AdrA function?

Site-directed mutagenesis represents a powerful approach for dissecting the structure-function relationships within the AdrA protein. By strategically altering specific amino acids, researchers can gain insights into catalytic mechanisms, regulatory interactions, and domain functions. Key methodological considerations include:

  • Target Selection Strategies:

    • Catalytic site residues within the GGDEF domain (focus on the GGDEF motif)

    • Conserved residues in the MASE2 domain across bacterial species

    • Predicted membrane-spanning regions and potential signal-sensing residues

    • Potential regulatory interfaces between domains

  • Technical Approaches:

    • QuikChange PCR-based mutagenesis for single or multiple mutations

    • Gibson Assembly for larger modifications or domain swapping

    • Golden Gate Assembly for combinatorial mutagenesis libraries

    • CRISPR-Cas9 mediated genomic editing for chromosomal mutations

  • Functional Validation Methods:

    • Enzymatic activity assays to assess catalytic function

    • Phenotypic assays (biofilm formation, motility) to evaluate physiological effects

    • Protein localization studies to confirm proper membrane insertion

    • Binding assays to assess interactions with regulatory partners

  • Structural Analysis Integration:

    • Correlation of mutational effects with homology models or crystal structures

    • Molecular dynamics simulations to predict effects of mutations

    • Analysis of conservation patterns across homologs to inform mutation design

By systematically altering key residues and evaluating the resulting effects on protein function, researchers can build a comprehensive understanding of how different domains and residues contribute to AdrA's role in bacterial signaling networks.

What experimental design approaches can optimize recombinant AdrA production?

Systematic experimental design methodologies can significantly enhance the efficiency of recombinant AdrA production. The Design of Experiment (DoE) approach provides a structured framework for identifying optimal expression conditions while minimizing the number of experiments required . Implementation includes:

  • Factor Identification and Selection:

    • Critical parameters affecting expression (temperature, inducer concentration, media composition)

    • Post-induction duration and harvesting time points

    • Strain selection and genetic background considerations

    • Fusion tag configurations and solubilization conditions

  • Experimental Design Methods:

    • Fractional factorial designs to screen multiple factors efficiently

    • Response surface methodology to optimize significant factors

    • Central composite designs to model complex factor interactions

    • Sequential optimization approaches to refine conditions iteratively

  • Response Measurement Techniques:

    • Quantification of total and soluble protein yield

    • Assessment of enzymatic activity and functional integrity

    • Evaluation of cell growth and metabolic burden

    • Analysis of protein localization and membrane integration

  • Statistical Analysis and Model Development:

    • ANOVA to identify significant factors and interactions

    • Regression modeling to predict optimal conditions

    • Contour plotting to visualize response surfaces

    • Validation experiments to confirm model predictions

This experimental design methodology has successfully developed process conditions achieving high levels (250 mg/L) of soluble recombinant protein expression in E. coli , demonstrating its potential for optimizing AdrA production while reducing operational costs.

What approaches can be used to study AdrA's role in bacterial signaling networks?

Understanding AdrA's position within complex bacterial signaling networks requires integrative experimental approaches that span from molecular interactions to systems-level analyses:

  • Genetic Interaction Mapping:

    • Epistasis analysis to establish hierarchical relationships (as shown between AdrA and SadB)

    • Synthetic genetic arrays to identify functional interactions

    • Suppressor screening to identify compensatory pathways

    • Targeted gene deletion and complementation studies

  • Protein Interaction Identification:

    • Bacterial two-hybrid assays for protein-protein interactions

    • Co-immunoprecipitation coupled with mass spectrometry

    • Proximity labeling approaches (BioID, APEX) for in vivo interaction mapping

    • Fluorescence resonance energy transfer (FRET) for dynamic interaction studies

  • Signaling Dynamics Monitoring:

    • Biosensor development for real-time c-di-GMP measurement

    • Single-cell analysis of signaling heterogeneity

    • Time-resolved studies of signal propagation

    • Microfluidic approaches for controlled environmental perturbation

  • Systems Biology Integration:

    • Transcriptomic profiling to identify AdrA-dependent gene expression

    • Metabolomic analysis of c-di-GMP-dependent metabolic shifts

    • Computational modeling of signaling network dynamics

    • Multi-omics data integration for comprehensive pathway mapping

These integrated approaches can reveal how AdrA functions within broader signaling networks that control transitions between motile and sessile bacterial lifestyles, biofilm formation, and environmental adaptation responses.

How might artificial intelligence tools advance our understanding of AdrA function and expression?

Emerging artificial intelligence (AI) tools offer promising opportunities to address complex questions regarding AdrA function and optimize its recombinant expression:

  • Protein Structure Prediction and Analysis:

    • AI-powered structure prediction (AlphaFold, RoseTTAFold) for full-length AdrA modeling

    • Simulation of membrane integration and conformational dynamics

    • Prediction of functional sites and allosteric mechanisms

    • Virtual screening for potential modulators of AdrA activity

  • Expression Optimization:

    • Machine learning for N-terminal sequence design to maximize expression

    • Predictive modeling of codon usage effects on translation efficiency

    • AI-guided experimental design for multi-parameter optimization

    • Pattern recognition in successful expression conditions across different proteins

  • Systems-Level Analysis:

    • Network inference from complex multi-omics datasets

    • Prediction of emergent properties in c-di-GMP signaling networks

    • Identification of non-obvious relationships between experimental variables

    • Integration of heterogeneous data types for comprehensive modeling

Recent developments suggest that AI tools could help clarify the relationship between host metabolism and recombinant protein production, though effective implementation will require more systematic experimental approaches to collect sufficiently uniform training data .

What are the potential applications of engineered AdrA variants in synthetic biology?

Engineered variants of AdrA hold significant potential for applications in synthetic biology and biotechnology:

  • Biofilm Engineering Applications:

    • Development of controlled biofilm formation systems for bioremediation

    • Creation of living materials with tunable adhesion properties

    • Engineering of biofilm-based biocatalysts with enhanced stability

    • Design of protective biofilms for probiotic delivery

  • Biosensing Platforms:

    • Engineering chimeric AdrA sensors responsive to specific environmental signals

    • Development of whole-cell biosensors for environmental monitoring

    • Creation of diagnostic tools based on biofilm formation readouts

    • Implementation of biocomputing circuits using c-di-GMP as a signaling molecule

  • Metabolic Engineering Tools:

    • Controlled regulation of cellular aggregation for improved bioproduction

    • Development of switchable production states in bacterial cell factories

    • Engineering of programmable cell-cell communication systems

    • Creation of synthetic biofilms with enhanced resistance to environmental stresses

  • Therapeutic Potential:

    • Development of inhibitors targeting AdrA homologs in pathogenic bacteria

    • Engineering of probiotics with controlled biofilm-forming capabilities

    • Creation of biofilm-disrupting strategies for infection treatment

    • Design of bacterial delivery systems for therapeutic compounds

The modular nature of AdrA, with distinct sensing and catalytic domains, makes it particularly amenable to engineering approaches aimed at creating novel functionalities for diverse biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.