Recombinant Escherichia coli Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Cell Division and Septation

YciB interacts with ZipA, a key cell division protein, to regulate septum formation. Deletion of yciB shortens cell length, while its overexpression causes filamentation, suggesting a role in modulating cell elongation . YciB also binds to proteins in the cell elongation machinery (e.g., FtsZ complex), indicating cross-talk between septation and elongation pathways .

Envelope Integrity and Stress Responses

YciB synergizes with DcrB, an inner membrane lipoprotein, to maintain cell envelope homeostasis. The yciB dcrB double mutant exhibits:

  • Membrane defects: Increased lipopolysaccharide (LPS) levels, vesiculation, and lethal inner membrane–peptidoglycan linkages .

  • Lipoprotein maturation defects: Impaired Lgt-mediated diacylglyceryl transfer to preprolipoproteins, leading to mislocalization of outer membrane (OM) lipoproteins like Lpp .

  • Stress pathway activation: Upregulation of Rcs and Cpx envelope stress response systems due to lipoprotein mislocalization .

Synthetic Lethality with DcrB

The yciB dcrB synthetic lethality arises from:

  • Copper sensitivity: MICs of 1 mM Cu²⁺ (vs. 2.25–2.75 mM in single mutants) .

  • Rescue mechanisms: Overexpression of Lgt restores viability by improving lipoprotein maturation .

Interaction Network

YciB forms functional partnerships with proteins involved in cell division and membrane dynamics :

Interacting PartnerFunctionInteraction Score
YciCUPF0259 family inner membrane protein0.973
YciAAcyl-CoA esterase0.859
DcrBPutative lipoprotein; required for phage adsorption0.591
GltKGlutamate/aspartate ABC transporter permease0.533

Research Applications

Recombinant YciB is utilized in:

  • Mechanistic studies: Elucidating bacterial cell division and envelope biogenesis pathways .

  • Stress response assays: Monitoring Rcs/Cpx activation under lipoprotein maturation defects .

  • Vaccine development: As an antigenic target for E. coli .

Key Research Findings

  • Membrane topology: YciB’s five transmembrane domains are critical for its interaction with cell division complexes .

  • Suppression of lethality: Deletion of lpp (a major OM lipoprotein) rescues yciB dcrB lethality by preventing toxic IM-PGN linkages .

  • Stress cross-talk: Cpx activation in yciB mutants is partially independent of lipoprotein defects, suggesting additional envelope stress signals .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; ispZ; b1254; JW1246; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQPVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
Recombinant Escherichia coli Probable intracellular septation protein A (yciB) plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis. It is essential for normal cell elongation and may participate in the cell division process. yciB is critical for the accurate localization of the essential divisome protein ZipA at the septum site. In the context of microbial infections, it is believed to transport the toxic C-terminal region of CdiA from E.coli strain 869 across the inner membrane to the cytoplasm, where CdiA degrades DNA. Toxin transport is strain-specific, and mutations in this gene do not confer resistance to several other tested CdiA toxins.
Gene References Into Functions
  1. A deletion mutant of yciB (DeltayciB) exhibits shorter cell length, while overexpression of yciB leads to cell elongation. PMID: 26391555
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the membrane topology of YciB in Escherichia coli?

YciB is a multi-pass inner membrane protein that contains five transmembrane domains. The membrane topology has been experimentally verified using dual pho-lac reporter systems, confirming the predicted structure. This topology is critical for understanding how YciB interacts with other proteins involved in cell envelope synthesis and maintenance . The transmembrane organization allows YciB to span the inner membrane with specific domains exposed to different cellular compartments, facilitating its functional interactions.

What are the known functional roles of YciB in Escherichia coli?

While the complete function of YciB has not been fully characterized, several roles have been identified. YciB interacts with various proteins involved in cell elongation and cell division processes. It has been found to be necessary for normal biofilm formation and interacts genetically with rodZ, a gene important for maintaining rod-type morphology . Additionally, deletion mutants of yciB show increased susceptibility to low osmolarity conditions, suggesting YciB plays a role in maintaining cell envelope integrity under osmotic stress. These observations collectively indicate that YciB is involved in synthesis of the cell envelope by interacting with cell elongation and division complexes.

How does YciB contribute to bacterial cell envelope integrity?

The bacterial cell envelope, consisting of the inner membrane and cell wall, serves as the primary stress-bearing and shape-maintaining element of bacterial cells. YciB contributes to this integrity through its interactions with proteins involved in cell elongation and division. The Escherichia coli genome contains over 800 genes encoding inner membrane proteins, and YciB is among those that play a critical role in maintaining envelope structure . Its role becomes particularly evident under low osmolarity conditions, where deletion mutants show increased susceptibility, indicating YciB's importance in adapting to osmotic changes and maintaining cellular structural integrity.

What are the recommended approaches for studying YciB membrane topology?

Studying YciB membrane topology requires specialized techniques for membrane protein analysis. The dual pho-lac reporter system has proven effective for determining whether protein segments are located in the cytoplasm or periplasm . In this approach, the gene encoding YciB is cloned into the pKTop plasmid, and the resulting construct is transformed into an E. coli strain like DH5α (phoA- lacZ-ΔM15). The color development on indicator plates reveals the cellular localization of the C-terminus.

Alternative approaches include:

  • Cysteine accessibility methods, where strategically placed cysteine residues are probed for accessibility

  • GFP fusion analysis to determine protein orientation

  • Protease protection assays to identify protected domains

Each method has specific advantages depending on the research question, but combining multiple approaches provides the most reliable topology mapping.

What experimental systems are effective for studying YciB protein interactions?

Bacterial two-hybrid systems have been successfully employed to identify proteins that interact with YciB, particularly those involved in cell elongation and division processes . This system allows for in vivo detection of protein-protein interactions by reconstituting a functional transcriptional activator when two proteins interact.

Additional methodologies include:

  • Co-immunoprecipitation followed by mass spectrometry to identify interaction partners

  • Cross-linking studies to capture transient interactions

  • Fluorescence resonance energy transfer (FRET) to visualize interactions in live cells

  • Split-GFP complementation assays to confirm specific interactions

When designing interaction studies, it's crucial to maintain the native membrane environment as much as possible, as detergent solubilization can disrupt physiologically relevant interactions.

How can researchers effectively generate and characterize yciB deletion mutants?

Creating yciB deletion mutants requires careful genetic manipulation to avoid polar effects on neighboring genes. Lambda Red recombineering is a preferred method, allowing precise deletion of yciB while preserving the reading frame and expression of adjacent genes. After constructing the deletion strain, comprehensive phenotypic characterization should include:

  • Growth curve analysis under various conditions (different media, temperatures, pH values)

  • Osmotic stress tolerance tests, given YciB's role in low osmolarity response

  • Biofilm formation assays, as YciB has been implicated in biofilm development

  • Cell morphology examination using phase contrast and electron microscopy

  • Peptidoglycan composition analysis to assess cell wall integrity

Complementation studies with plasmid-expressed YciB should be conducted to confirm that observed phenotypes are specifically due to the absence of YciB rather than secondary mutations.

How does YciB interact with the cell elongation and division machinery?

YciB has been found to interact with multiple components of the cell elongation and division complexes . These interactions likely occur through specific domains of the YciB protein that are exposed to either the cytoplasm or periplasm, based on its membrane topology. The interaction network may include proteins involved in peptidoglycan synthesis, such as penicillin-binding proteins (PBPs), as well as cytoskeletal proteins like MreB and FtsZ that guide cell wall synthesis.

Research approaches to further characterize these interactions should include:

  • Site-directed mutagenesis to identify specific residues required for protein-protein interactions

  • Subcellular localization studies using fluorescently tagged proteins to observe co-localization patterns

  • In vitro reconstitution of minimal interaction systems

  • Suppressor mutation analysis to identify genetic interactions

Understanding these interactions at the molecular level will provide insight into how YciB coordinates with other proteins to maintain cell envelope integrity during growth and division.

What is the relationship between YciB and bacterial biofilm formation?

YciB has been identified as a gene required for normal biofilm formation . This connection suggests YciB may influence bacterial surface properties, cell-cell adhesion, or extracellular matrix production. To investigate this relationship, researchers should consider:

  • Comparing biofilm architecture between wild-type and ΔyciB strains using confocal microscopy

  • Analyzing extracellular polysaccharide and protein composition in biofilms

  • Measuring cell surface hydrophobicity and charge

  • Examining expression of known biofilm-related genes in the absence of YciB

  • Testing biofilm formation under various environmental stressors

The mechanistic link between YciB's membrane function and biofilm formation remains to be fully elucidated and represents an important area for future research.

How does YciB contribute to bacterial adaptation to osmotic stress?

Deletion mutants of yciB show increased susceptibility to low osmolarity conditions , suggesting YciB plays a role in osmotic stress adaptation. This phenotype may be related to alterations in cell envelope structure or composition that affect its mechanical properties. Advanced research approaches to explore this function include:

  • Measuring cell envelope elasticity using atomic force microscopy

  • Analyzing membrane lipid composition changes in response to osmotic shifts

  • Monitoring cytoplasmic solute concentrations during osmotic challenges

  • Examining interactions between YciB and osmosensing proteins

  • Conducting transcriptomic and proteomic analyses to identify pathways affected by YciB deletion under osmotic stress

Understanding YciB's role in osmotic adaptation may reveal broader principles about bacterial stress responses and membrane homeostasis.

How can researchers resolve conflicting data about YciB function?

As with many membrane proteins with subtle phenotypes, research on YciB may produce apparently contradictory results. To resolve such conflicts, researchers should:

  • Carefully consider strain background differences, as genetic context can significantly influence phenotypes

  • Standardize growth conditions and experimental parameters across studies

  • Use multiple complementary techniques to address the same question

  • Perform quantitative rather than qualitative analyses when possible

  • Consider potential pleiotropic effects of YciB deletion or overexpression

For example, if one study finds YciB affects cell morphology while another does not, researchers should examine differences in growth media, temperature, or expression systems that might explain the discrepancy. Collaborative cross-validation between laboratories can also help resolve contradictory findings.

What statistical approaches are most appropriate for analyzing YciB phenotypic data?

When analyzing phenotypic data from YciB studies, appropriate statistical methods are essential. For growth and stress response experiments:

  • Use repeated measures ANOVA for growth curve analysis

  • Apply survival analysis techniques for stress tolerance tests

  • Implement multivariate statistics for comparing multiple phenotypic parameters simultaneously

  • Consider Bayesian approaches for integrating prior knowledge with new data

  • Use appropriate multiple testing corrections when screening numerous conditions

Sample size calculations should be performed prior to experiments to ensure adequate statistical power. Additionally, researchers should report effect sizes alongside p-values to convey the magnitude of YciB's impact on cellular processes.

How can researchers distinguish direct versus indirect effects of YciB on cellular processes?

Distinguishing direct from indirect effects is a common challenge in functional studies of membrane proteins. To address this challenge with YciB research:

  • Use rapid induction or depletion systems to observe immediate versus delayed effects

  • Conduct time-course experiments to establish the sequence of cellular changes

  • Create point mutations that affect specific functions rather than deleting the entire protein

  • Use in vitro reconstitution with purified components to confirm direct biochemical activities

  • Apply systems biology approaches to model the network of interactions

For example, if YciB deletion affects both biofilm formation and cell division, temporal analysis of when each phenotype manifests can help determine the primary effect versus downstream consequences.

What approaches might reveal the evolutionary significance of YciB conservation?

YciB is part of the Escherichia coli genome, which contains over 800 genes encoding inner membrane proteins . Understanding the evolutionary significance of YciB conservation requires:

  • Comprehensive phylogenetic analysis across bacterial species

  • Identification of co-evolving genes that may function with YciB

  • Structural comparison with homologs from diverse bacteria

  • Functional complementation studies using YciB homologs from other species

  • Analysis of selection pressures on different domains of the protein

These approaches may reveal whether YciB represents a core bacterial function or a specialized adaptation to particular ecological niches, providing context for its role in E. coli physiology.

How might high-throughput approaches advance understanding of YciB function?

Emerging high-throughput technologies offer new possibilities for YciB research:

  • CRISPRi screens to identify synthetic lethal or synthetic sick interactions

  • Transposon sequencing (Tn-seq) under various stress conditions to map genetic relationships

  • High-content microscopy to analyze morphological effects in large populations

  • Proteome-wide interaction mapping using proximity labeling approaches

  • Systematic mutagenesis coupled with deep sequencing to identify functional domains

These approaches can generate comprehensive datasets that, when integrated, may reveal previously unrecognized aspects of YciB function and its relationship to cellular physiology.

What are the most promising directions for translating basic YciB research into practical applications?

While this FAQ focuses on academic research rather than commercial applications, understanding YciB function may ultimately contribute to practical advances:

  • Development of new antimicrobial strategies targeting bacterial cell envelope biogenesis

  • Engineering bacterial strains with modified biofilm properties for biotechnology applications

  • Creating biosensors based on YciB's response to osmotic stress

  • Improving protein production systems through enhanced membrane protein biogenesis

Researchers should consider how fundamental discoveries about YciB biology might contribute to these longer-term translational goals, while maintaining focus on rigorous basic research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.