Recombinant Escherichia coli Probable L,D-transpeptidase YcbB (ycbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycbB; b0925; JW0908; Probable L,D-transpeptidase YcbB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-615
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ycbB
Target Protein Sequence
MLLNMMCGRQLSAISLCLAVTFAPLFNAQADEPEVIPGDSPVAVSEQGEALPQAQATAIM AGIQPLPEGAAEKARTQIESQLPAGYKPVYLNQLQLLYAARDMQPMWENRDAVKAFQQQL AEVAIAGFQPQFNKWVELLTDPGVNGMARDVVLSDAMMGYLHFIANIPVKGTRWLYSSKP YALATPPLSVINQWQLALDKGQLPTFVAGLAPQHPQYAAMHESLLALLCDTKPWPQLTGK ATLRPGQWSNDVPALREILQRTGMLDGGPKITLPGDDTPTDAVVSPSAVTVETAETKPMD KQTTSRSKPAPAVRAAYDNELVEAVKRFQAWQGLGADGAIGPATRDWLNVTPAQRAGVLA LNIQRLRLLPTELSTGIMVNIPAYSLVYYQNGNQVLDSRVIVGRPDRKTPMMSSALNNVV VNPPWNVPPTLARKDILPKVRNDPGYLESHGYTVMRGWNSREAIDPWQVDWSTITASNLP FRFQQAPGPRNSLGRYKFNMPSSEAIYLHDTPNHNLFKRDTRALSSGCVRVNKASDLANM LLQDAGWNDKRISDALKQGDTRYVNIRQSIPVNLYYLTAFVGADGRTQYRTDIYNYDLPA RSSSQIVSKAEQLIR
Uniprot No.

Target Background

Function
Plays a role, at least in part, in the generation of meso-diaminopimelyl-3-a meso-diaminopimelyl-3 cross-links.
Gene References Into Functions
  1. Research indicates that activation of the Cpx response increases the abundance of diaminopimelic acid (DAP)-DAP cross-links, a process involving LdtD and YgaU. PMID: 25422305
Database Links
Protein Families
YkuD family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the biological function of L,D-transpeptidase YcbB in Escherichia coli?

L,D-transpeptidase YcbB is an enzyme in E. coli that catalyzes the formation of 3→3 peptidoglycan cross-links in the bacterial cell wall. Unlike the more common D,D-transpeptidases (Penicillin-Binding Proteins or PBPs), which form 4→3 cross-links, YcbB creates direct links between two diaminopimelic acid (DAP) residues in adjacent peptide stems. Research has demonstrated that YcbB possesses two enzymatic activities:

  • L,D-transpeptidase activity: Forms DAP 3→DAP 3 cross-links between peptidoglycan strands

  • L,D-carboxypeptidase activity: Removes the C-terminal D-Alanine (D-Ala) residue from tetrapeptide stems

In vitro studies with purified YcbB have confirmed that when incubated with disaccharide-tetrapeptide substrates derived from E. coli peptidoglycan, the enzyme forms peptidoglycan dimers containing DAP 3→DAP 3 cross-links, validating its role as a bona fide L,D-transpeptidase .

How does YcbB contribute to β-lactam antibiotic resistance in bacteria?

YcbB contributes to β-lactam resistance through a unique bypass mechanism. Unlike PBPs (which are effectively inhibited by β-lactams), L,D-transpeptidases like YcbB are slowly acylated by penam and cephem class antibiotics, and the resulting acyl-enzymes are unstable. This combination of slow acylation and acyl-enzyme hydrolysis results in only partial inhibition of YcbB .

When YcbB is expressed at appropriate levels, it can completely replace the D,D-transpeptidase activity of all five class A and B PBPs in E. coli, allowing peptidoglycan synthesis to continue even in the presence of β-lactams that inactivate PBPs. This bypass mechanism leads to resistance against antibiotics like ampicillin and ceftriaxone .

Key factors required for successful YcbB-mediated β-lactam resistance include:

  • Controlled expression of YcbB (excessive levels are toxic)

  • Upregulation of (p)ppGpp alarmone synthesis

  • Additional chromosomal mutations that support YcbB-mediated peptidoglycan synthesis

  • Presence of enzyme partners required for peptidoglycan polymerization

What is the structural composition of YcbB and how does it relate to function?

The crystallographic structure of YcbB reveals a complex multi-domain architecture with several distinctive features:

  • A conserved central L,D-transpeptidase catalytic domain (residues 375-576)

  • A unique substrate capping sub-domain consisting of:

    • A small three-stranded beta-sheet (β6,8,7)

    • An α-helix (α13) positioned perpendicular to the beta-sheet

    • A large loop region between beta-strands 7 and 8 (residues 453-481)

  • An extended electropositive active site marked by bound meropenem antibiotic

  • Appropriate clefts for both donor and acceptor substrates

The catalytic domain contains the conserved active site motif characteristic of L,D-transpeptidases. Unlike L,D-transpeptidases from Gram-positive bacteria, YcbB exhibits a unique structural element - the substrate capping sub-domain that contains significant secondary structural elements rather than just loops. This sub-domain appears to hinge toward the active site in the meropenem acyl-enzyme complex structure, suggesting its involvement in substrate recognition and binding .

What are the essential genetic and environmental factors required for YcbB-mediated β-lactam resistance?

Multiple factors are necessary for YcbB to successfully mediate β-lactam resistance in E. coli:

  • Optimal YcbB expression levels: High-level production of YcbB is toxic to E. coli, likely due to its putative membrane anchor. Mutations in regulatory elements (such as the lacI gene in experimental settings) that moderate YcbB expression are essential for resistance without toxicity .

  • Chromosomal mutations: Studies have shown that plasmid-mediated YcbB expression alone is insufficient for ampicillin resistance. Additional chromosomal mutations are required, as evidenced by the inability to select ampicillin-resistant derivatives from strains containing only the YcbB-expressing plasmid (survivor frequency <10^-9) .

  • Upregulation of (p)ppGpp alarmone synthesis: The stringent response alarmone (p)ppGpp plays a crucial role in YcbB-mediated resistance. Production of YcbB was found to switch the role of (p)ppGpp from antibiotic tolerance to high-level β-lactam resistance .

  • Essential enzyme partners: Systematic screening using E. coli Keio collection mutants revealed that YcbB requires specific enzyme partners for peptidoglycan polymerization. Deletion of genes encoding these essential partners prevents acquisition of ampicillin resistance despite YcbB production .

These requirements highlight the complex and multifactorial nature of YcbB-mediated β-lactam resistance, involving not just the presence of the enzyme but also appropriate cellular conditions and partner proteins.

How does the composition of peptidoglycan cross-links change when YcbB becomes the dominant transpeptidase?

When YcbB becomes the dominant transpeptidase in E. coli cell wall synthesis, there is a dramatic shift in the peptidoglycan cross-link composition:

  • In normal conditions with functioning PBPs, the peptidoglycan contains primarily 4→3 cross-links formed by D,D-transpeptidases

  • When YcbB replaces PBP function (such as during β-lactam exposure), the peptidoglycan shifts to containing predominantly or exclusively 3→3 cross-links

This structural change has been experimentally verified through tandem mass spectrometry analysis of purified peptidoglycan fragments from E. coli mutants expressing YcbB in the presence of ampicillin. The analysis confirmed that when PBP activity is inhibited by β-lactams, all detectable cross-links are of the 3→3 type, demonstrating that YcbB alone is sufficient for complete peptidoglycan cross-linking .

This alteration in cross-link chemistry represents a remarkable example of bacterial adaptability, allowing cell wall synthesis to continue through an alternative pathway when the primary mechanism is blocked by antibiotics.

What methodologies are most effective for analyzing YcbB-mediated peptidoglycan synthesis in vivo and in vitro?

For comprehensive analysis of YcbB-mediated peptidoglycan synthesis, researchers should employ a multi-faceted approach:

In vivo analysis methods:

  • Genetic manipulation and selection systems:

    • Controlled expression systems using inducible promoters (e.g., IPTG-inducible trc promoter)

    • Selection on β-lactam containing media to identify resistant mutants

    • Construction of deletion mutants lacking competing L,D-transpeptidases (e.g., BW25113Δ4 strain lacking ynhG, ybiS, erfK, and ycfS)

  • Peptidoglycan composition analysis:

    • Isolation and purification of peptidoglycan from bacterial cultures

    • HPLC analysis of muropeptides following digestion with muramidases

    • Tandem mass spectrometry to determine cross-link sequence and quantify 3→3 versus 4→3 cross-links

  • Whole genome sequencing:

    • Illumina sequencing to identify chromosomal mutations that enable YcbB-mediated resistance

    • Bioinformatic analysis using platforms such as CLC Genomics Workbench

In vitro analysis methods:

  • Recombinant protein production and purification:

    • Expression of soluble YcbB fragments (without membrane anchor to avoid toxicity)

    • Affinity chromatography purification

  • Enzymatic activity assays:

    • Incubation of purified YcbB with disaccharide-tetrapeptide substrates

    • Mass spectrometry analysis of reaction products to detect:

      • Dimer formation (transpeptidase activity)

      • Tetrapeptide conversion to tripeptide (carboxypeptidase activity)

  • Structural studies:

    • X-ray crystallography of YcbB in apo form and in complex with substrates or inhibitors

    • Analysis of domain movements during catalysis, particularly the substrate capping sub-domain

For the most comprehensive understanding, researchers should combine these approaches to correlate structural features, enzymatic activities, and physiological outcomes in the context of antibiotic resistance.

How does the substrate capping sub-domain of YcbB impact its catalytic mechanism and substrate specificity?

The substrate capping sub-domain of YcbB represents a unique structural feature that likely plays a crucial role in the enzyme's catalytic mechanism and substrate specificity:

Structural characteristics and dynamics:

  • Unlike other L,D-transpeptidases that possess simple loops (3-19 residues) over the active site, YcbB contains significant secondary structural elements forming a folded sub-domain (residues 423-487)

  • This sub-domain comprises a three-stranded beta-sheet (β6,8,7) and an α-helix (α13) positioned perpendicular to the beta-sheet

  • A large loop region between beta-strands 7 and 8 (residues 453-481) provides additional structural complexity

  • Crystallographic evidence shows that beta-strand 6 and α-helix 13 hinge toward the active site in the meropenem acyl-enzyme complex structure

Proposed functional implications:

  • Substrate selection and positioning:

    • The capping sub-domain likely creates a specific microenvironment around the active site that determines which peptidoglycan components can access the catalytic center

    • The hinged movement observed in the meropenem-bound structure suggests the sub-domain undergoes conformational changes during substrate binding and catalysis

  • Catalytic efficiency modulation:

    • The dynamic nature of this domain may regulate substrate access and product release

    • Conformational changes could potentially explain YcbB's dual transpeptidase and carboxypeptidase activities

  • Antibiotic resistance mechanism:

    • The unique structure of this domain might contribute to YcbB's reduced susceptibility to β-lactams by affecting how these antibiotics interact with the active site

    • The domain's movement during catalysis may influence the stability of acyl-enzyme complexes formed with β-lactams

These structural features distinguish YcbB from previously characterized L,D-transpeptidases and likely contribute to its unique functional properties in E. coli peptidoglycan synthesis and antibiotic resistance.

What molecular mechanisms underlie YcbB toxicity when overexpressed in E. coli?

The toxicity observed with high-level YcbB expression in E. coli represents an important consideration for both experimental work and understanding bacterial physiology. Several molecular mechanisms likely contribute to this toxicity:

Membrane disruption hypothesis:

  • YcbB contains a putative membrane anchor, and research suggests that the toxicity may be linked to this structural feature

  • Similar membrane anchors in other proteins, like PBP2 in E. coli, have been demonstrated to cause toxicity when overexpressed

  • Excessive insertion of membrane-anchored proteins can potentially disrupt membrane integrity, perturb lipid organization, or interfere with essential membrane-associated processes

Peptidoglycan homeostasis disruption:

  • Unregulated L,D-transpeptidase activity could alter the balance of 3→3 versus 4→3 cross-links in peptidoglycan

  • Such alterations might compromise cell wall integrity or interfere with normal cell division processes

  • Excessive carboxypeptidase activity of YcbB might deplete the tetrapeptide substrates needed for normal PBP-mediated cross-linking

Enzyme competition and metabolic burden:

  • Overexpressed YcbB may compete with endogenous PBPs for peptidoglycan substrates

  • The resulting imbalance in cell wall synthesis pathways could lead to structural weaknesses or abnormalities

  • The metabolic burden of producing large amounts of the protein might also contribute to growth inhibition

Experimental evidence and implications:

  • In experimental settings, mutations in regulatory elements (such as the lacI gene) that moderate YcbB expression levels are necessary to prevent toxicity while maintaining β-lactam resistance

  • This toxicity explains why natural β-lactam resistance through YcbB upregulation requires precisely regulated expression rather than simple overexpression

  • Understanding these toxicity mechanisms is crucial for designing expression systems for biochemical and structural studies of YcbB

How can structural knowledge of YcbB be leveraged to design novel antibiotics that overcome L,D-transpeptidase-mediated resistance?

The structural insights into YcbB provide valuable opportunities for rational drug design to overcome this resistance mechanism:

Structure-based inhibitor design strategies:

  • Active site targeting:

    • The extended electropositive active site of YcbB with its bound meropenem provides a template for designing more effective inhibitors

    • Compounds that form more stable acyl-enzyme complexes or that inhibit through non-covalent mechanisms could be developed

    • The catalytic cysteine residue presents an opportunity for designing selective covalent inhibitors

  • Exploiting unique structural features:

    • The substrate capping sub-domain of YcbB is distinct from other L,D-transpeptidases and could be targeted for selective inhibition

    • Compounds that interfere with the hinging motion of beta-strand 6 and α-helix 13 could potentially lock the enzyme in an inactive conformation

    • The clefts for donor and acceptor substrates offer additional binding sites for competitive inhibitors

  • Dual-targeting approaches:

    • Development of hybrid molecules that simultaneously inhibit both D,D-transpeptidases (PBPs) and L,D-transpeptidases

    • This approach would prevent the bypass mechanism that enables β-lactam resistance

Potential drug development workflow:

  • Virtual screening and molecular docking:

    • Use the YcbB crystal structure to screen virtual compound libraries

    • Identify molecules predicted to bind the active site or interfere with the substrate capping sub-domain

  • Biochemical validation:

    • Synthesize candidate compounds and test their inhibitory activity against purified YcbB

    • Determine inhibition mechanisms (competitive, non-competitive, irreversible)

    • Assess selectivity against other L,D-transpeptidases and PBPs

  • Structural confirmation:

    • Obtain co-crystal structures of YcbB with promising inhibitors to confirm binding modes

    • Use this information for further structure-based optimization

  • Antibacterial efficacy testing:

    • Evaluate inhibitors against YcbB-expressing resistant bacterial strains

    • Determine minimum inhibitory concentrations and spectrum of activity

    • Assess potential for resistance development

This structural knowledge provides a foundation for developing next-generation antibiotics that maintain efficacy against bacteria using L,D-transpeptidase-mediated resistance mechanisms.

What is the evolutionary significance of YcbB and related L,D-transpeptidases in bacterial adaptation to β-lactam pressure?

The presence and function of YcbB in E. coli represents a fascinating example of bacterial evolutionary adaptation to antibiotic pressure:

Evolutionary conservation and divergence:

  • L,D-transpeptidases like YcbB show significant structural and sequence divergence across bacterial species (7.1-14.3% sequence identity between E. coli YcbB and L,D-transpeptidases from Gram-positive and mycobacterial species)

  • This divergence suggests independent evolutionary paths adapting these enzymes to species-specific cell wall architecture and environmental challenges

  • The acquisition of unique structural elements, such as YcbB's substrate capping sub-domain, reflects evolutionary innovation in enzyme function

Adaptive significance for antibiotic resistance:

  • The ability of YcbB to form 3→3 cross-links provides a backup mechanism for cell wall synthesis when the primary 4→3 cross-linking by PBPs is inhibited

  • This represents a pre-adaptation that allows bacteria to survive β-lactam exposure through a complementary peptidoglycan synthesis pathway

  • The requirement for additional mutations for full resistance suggests this mechanism involves co-evolution of multiple cellular systems

Regulatory evolution:

  • The toxicity associated with YcbB overexpression indicates evolutionary pressure to maintain tight regulation of this enzyme

  • Natural selection would favor regulatory mechanisms that enable appropriate YcbB expression only when needed (i.e., during β-lactam exposure)

  • The connection between (p)ppGpp alarmone synthesis and YcbB-mediated resistance suggests evolution has integrated this resistance mechanism with the bacterial stress response

Clinical and ecological implications:

  • The presence of YcbB and similar L,D-transpeptidases across bacterial species represents a reservoir of potential resistance mechanisms

  • Environmental antibiotic pressure may select for mutations that enable more efficient YcbB-mediated resistance

  • This evolutionary adaptation highlights the challenges in developing lasting antibiotic strategies and emphasizes the need for approaches that target multiple cell wall synthesis pathways simultaneously

Understanding the evolutionary context of YcbB provides crucial insights into bacterial adaptation mechanisms and may inform both antibiotic stewardship practices and the development of resistance-resistant antimicrobial strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.