Recombinant Escherichia coli Probable Ni/Fe-hydrogenase 1 B-type cytochrome subunit (hyaC)

Shipped with Ice Packs
In Stock

Description

Introduction to Hydrogenase Systems in Escherichia coli

Escherichia coli synthesizes at least three distinct [NiFe]-hydrogenases that function under various environmental conditions . Among these, hydrogenase-1 (Hyd-1), which contains the HyaC subunit, has evolved specialized characteristics that enable hydrogen metabolism even under challenging oxidative conditions. The hydrogenase-1 enzyme is encoded by the hyaABC genes, with hyaC specifically coding for the b-type cytochrome subunit that plays a critical role in electron transfer during hydrogen oxidation .

Hydrogenase-1 stands out among E. coli's hydrogen-metabolizing enzymes due to its remarkable oxygen tolerance, allowing it to function even in aerobic environments—a property that distinguishes it from most other hydrogenases, which are typically oxygen-sensitive . This unique characteristic makes HyaC and the hydrogenase-1 complex particularly interesting for both fundamental research and potential biotechnological applications in sustainable energy production.

Hydrogen Oxidation and Electron Transfer

The hydrogenase-1 complex, with HyaC as an integral component, primarily functions in the oxidation of molecular hydrogen under various conditions. This enzyme demonstrates several key biochemical activities:

  1. Catalyzes H2:benzyl viologen oxidoreduction

  2. Facilitates H2 evolution with methyl viologen as an electron donor

  3. Participates in nitrate-dependent and DMSO-dependent H2 consumption

  4. Functions in the Knallgas reaction (2H2 + O2 → 2H2O)

  5. Efficiently oxidizes H2 under oxic conditions while being less effective with lower-potential electron acceptors like methyl viologen or fumarate

Unlike hydrogenase-2 (Hyd-2), which can function bidirectionally, hydrogenase-1 is specifically optimized for unidirectional H2 oxidation and cannot effectively operate in reverse to produce hydrogen . This specialization reflects its physiological role as an electron donor to high-potential respiratory chain components.

Oxygen Tolerance Mechanisms

Perhaps the most remarkable feature of hydrogenase-1 and its HyaC subunit is the ability to function in the presence of oxygen, a property that distinguishes it from most hydrogenases. This oxygen tolerance appears to be partially facilitated by the enzyme's ability to catalyze the direct four-electron reduction of oxygen to water using H2 as a donor . When hydrogenase-1 reacts exclusively with H2 and oxygen, approximately 86% of the water produced arises from this direct reaction pathway .

The oxidase activity of hydrogenase-1, while relatively low compared to dedicated oxidases, serves to protect the active site from oxygen attack . This protective mechanism allows the enzyme to maintain hydrogen oxidation activity even under fluctuating oxygen concentrations, making it particularly valuable in microaerobic ecological niches.

Environmental Regulation

The expression of the hya operon, which includes the hyaC gene, is tightly regulated by environmental conditions. Several key factors influence hyaC expression:

  1. Oxygen availability: Expression occurs exclusively under anaerobic conditions

  2. External pH: HyaC expression follows a decline in external pH, with higher expression in acidic than alkaline environments

  3. Growth phase: Expression patterns correlate with specific growth phases in E. coli cultures

Experimental studies have demonstrated that when buffered media are used with fixed pH values, the onset of hya expression initiates earlier in growth and reaches greater peak levels in acidic compared to alkaline conditions . This pH-dependent regulation suggests a physiological role for hydrogenase-1 in acidic anaerobic environments.

Transcriptional Control

The maximal expression of the hya operon requires several key transcriptional regulators:

  1. Sigma factor RpoS

  2. Transcriptional regulator AppY

  3. Transcriptional regulator ArcA

These factors work in concert to fine-tune hydrogenase-1 expression in response to environmental cues. Notably, the absence of ArcA leads to a diminished response of expression onset to external pH and eliminates the elevated expression typically observed at acidic pH . This contrasts with hydrogenase-2 (encoded by the hyb operon), which shows constitutive expression onset with respect to pH but exhibits maximal expression under alkaline rather than acidic conditions .

Expression Systems

Recombinant HyaC protein is typically produced in E. coli expression systems, which provide several advantages for the production of this bacterial membrane protein. The expression construct usually includes an N-terminal histidine tag to facilitate purification via immobilized metal affinity chromatography (IMAC) .

Ecological Significance

Hydrogenase-1, containing the HyaC subunit, appears to function primarily as an energy-conserving H2 scavenger under conditions of slow growth and fluctuating oxygen levels . This specialized role reflects the enzyme's unique properties, including its:

  1. Oxygen tolerance

  2. Preference for high-potential electron acceptors

  3. Enhanced activity under acidic conditions

  4. Unidirectional operation (H2 oxidation only)

These characteristics suggest that hydrogenase-1 occupies a specific ecological niche in E. coli's energy metabolism strategy, allowing the organism to utilize hydrogen as an electron source even in environments where oxygen levels fluctuate unpredictably.

Membrane Anchoring and Electron Transport

The HyaC subunit plays a critical role in anchoring the hydrogenase-1 complex to the cytoplasmic membrane. The complex is embedded in the membrane through both the HyaA C-terminal helix and the HyaC membrane anchor . This membrane association is crucial for the integration of hydrogen oxidation with the respiratory electron transport chain.

As a b-type cytochrome, HyaC contains heme groups that participate in electron transfer from the catalytic site where hydrogen oxidation occurs to respiratory chain components in the membrane. This electron transfer capability is essential for energy conservation during hydrogen metabolism.

Potential Applications

The unique properties of HyaC and the hydrogenase-1 complex offer several promising applications:

  1. Hydrogen fuel cells: The oxygen tolerance of hydrogenase-1 makes it potentially valuable for biofuel cell applications where traditional hydrogenases are inactivated by oxygen.

  2. Biosensors: The specific activity of the enzyme could be harnessed to develop highly sensitive biological sensors for hydrogen detection.

  3. Biocatalysis: The enzyme's ability to function under acidic conditions and variable oxygen concentrations could be valuable for industrial biocatalytic processes.

  4. Synthetic biology: Engineered variants of HyaC could potentially enhance hydrogen metabolism capabilities in designer microorganisms for biotechnological applications.

Research Applications of Recombinant HyaC

Recombinant HyaC serves several important research purposes:

  1. Structural studies: Purified protein enables detailed structural analyses through crystallography and other biophysical techniques.

  2. Mechanism investigations: The isolated subunit allows for detailed biochemical studies of electron transfer mechanisms.

  3. Protein-protein interaction studies: Recombinant HyaC facilitates investigations into interactions with other hydrogenase components and respiratory chain proteins.

  4. Antibody production: The purified protein can be used to generate specific antibodies for detection and localization studies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
hyaC; b0974; JW0956; Probable Ni/Fe-hydrogenase 1 B-type cytochrome subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
hyaC
Target Protein Sequence
MQQKSDNVVSHYVFEAPVRIWHWLTVLCMAVLMVTGYFIGKPLPSVSGEATYLFYMGYIR LIHFSAGMVFTVVLLMRIYWAFVGNRYSRELFIVPVWRKSWWQGVWYEIRWYLFLAKRPS ADIGHNPIAQAAMFGYFLMSVFMIITGFALYSEHSQYAIFAPFRYVVEFFYWTGGNSMDI HSWHRLGMWLIGAFVIGHVYMALREDIMSDDTVISTMVNGYRSHKFGKISNKERS
Uniprot No.

Target Background

Function
Probable b-type cytochrome.
Database Links
Protein Families
HupC/HyaC/HydC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of the B-type cytochrome subunit (hyaC) in E. coli Ni/Fe-hydrogenase complexes?

The B-type cytochrome subunit (hyaC) functions as a critical electron transfer component within the Ni/Fe-hydrogenase 1 complex in E. coli. Unlike the catalytic subunits that contain the Ni-Fe center, hyaC contains heme groups that facilitate electron movement between the catalytic center and cellular electron carriers. When expressing recombinant hydrogenases, it's essential to consider that proper assembly of the entire complex, including accessory subunits like hyaC, is required for full catalytic function. The cytochrome subunit's integration into the membrane and proper folding is necessary for establishing the electron transport chain that connects hydrogenase activity to cellular metabolism .

What expression vectors are most suitable for recombinant production of hydrogenase components in E. coli?

For recombinant production of hydrogenase components including hyaC, multicopy plasmids with inducible promoters are typically employed. Based on successful expression of related hydrogenase systems, optimal vector selection should consider: (1) Promoter strength and inducibility – IPTG-inducible or auto-induction systems have proven effective for hydrogenase component expression; (2) Copy number – medium-copy plasmids often balance protein yield with metabolic burden; (3) Compatibility with co-expression systems – dual-plasmid systems may be necessary when co-expressing maturation factors. For instance, research on regulatory hydrogenases demonstrated successful expression using IPTG-inducible systems with yields reaching 250 mg L⁻¹ in fed-batch-like growth conditions .

How do I design a basic purification protocol for recombinant hyaC expressed in E. coli?

A methodological approach to purifying recombinant hyaC should include:

  • Affinity tag selection: N-terminal or C-terminal His-tags (6×His) facilitate single-step purification while maintaining protein function

  • Cell lysis optimization: Gentle disruption methods to preserve membrane-associated cytochrome integrity

  • Solubilization: Carefully selected detergents to extract membrane-associated proteins without denaturation

  • Chromatography: Immobilized metal affinity chromatography (IMAC) as primary purification step

  • Quality assessment: SDS-PAGE analysis to confirm purity and integrity

Successful single-step affinity chromatography has been demonstrated for related hydrogenase components, yielding highly purified protein suitable for downstream applications .

What strategies can address cell filamentation issues during overexpression of hydrogenase components?

Cell filamentation during recombinant hydrogenase component expression represents a significant challenge that can drastically reduce yields. Methodological solutions include:

Research has shown that the co-expression of ftsA and ftsZ genes increased both the specific growth rate of recombinant E. coli (1.3-fold) and the volumetric productivity of heterologous proteins (2-fold) by effectively preventing stress-induced filamentation .

What factors are critical for ensuring proper incorporation of the Ni-Fe cofactor in recombinantly expressed hydrogenases?

Proper maturation of the [NiFe] center is essential for catalytic activity. Key methodological considerations include:

  • Co-expression of maturation machinery: The complete set of hydrogenase-specific maturases must be co-expressed. For example, successful maturation of [NiFe]-hydrogenases required co-expression of seven hydrogenase-specific maturases (hypA1B1F1CDE) .

  • Metal availability optimization: Supplementation with NiCl₂ significantly increases hydrogenase activity (from 0.07 U mg⁻¹ to 0.28 U mg⁻¹ in one study). Careful optimization of metal concentration is necessary to avoid toxicity .

  • Oxygen regulation: While many hydrogenases are oxygen-sensitive, controlled microaerobic conditions can balance cell growth with proper cofactor incorporation.

  • Temperature and time parameters: Lower cultivation temperatures (18°C) with extended production times (66h) have shown improved specific activity of hydrogenases (up to 0.5 U mg⁻¹) .

  • Co-expression of metal transport systems: Addition of specific metal permeases (like the HoxN nickel permease) can significantly improve metal incorporation even under aerobic conditions .

The optimization of these factors has resulted in up to 160-fold improvement in space-time yield compared to native host expression systems .

How can I differentiate between inactive apoprotein and catalytically competent holoenzyme forms of recombinant hydrogenases?

Methodological approaches to distinguish between apoprotein (lacking cofactors) and catalytically active holoenzyme include:

  • Spectroscopic analysis:

    • IR spectroscopy: Active [NiFe] centers show characteristic CO and CN⁻ stretching frequencies

    • EPR spectroscopy: Properly assembled [NiFe] centers display distinctive EPR signals representing different redox states

  • Activity assays:

    • Hydrogen oxidation assays using artificial electron acceptors

    • Hydrogen production assays coupled with gas chromatography

  • Structural characterization:

    • Circular dichroism to assess proper folding

    • Size exclusion chromatography to evaluate oligomeric state integrity

  • Metal content analysis:

    • ICP-MS quantification of nickel and iron content

    • Colorimetric assays for metal incorporation

These methodologies should be applied in combination to provide comprehensive evidence of proper cofactor incorporation and activation .

What growth conditions optimize the expression of functional hyaC in recombinant E. coli systems?

Optimizing expression conditions requires systematic evaluation of multiple parameters:

ParameterRecommended RangeEffect on Production
Temperature18-30°CLower temperature (18°C) increases specific activity but may decrease volumetric yield
Oxygen levelMicroaerobic to aerobicOxygen affects both cell growth and cofactor incorporation
Metal supplementation50-100 μM NiCl₂Essential for cofactor incorporation without toxicity
Induction timingMid-log phase (OD₆₀₀ 0.6-0.8)Balances cell density with protein expression capacity
Production duration29-66hExtended time improves maturation, especially at lower temperatures

How do E. coli strain backgrounds influence the expression and activity of recombinant hydrogenases?

The choice of E. coli strain significantly impacts recombinant hydrogenase expression success:

  • K-12 derivatives (e.g., MC4100):

    • Advantages: Well-characterized genetic background, reduced protease activity

    • Limitations: May require supplementation with specific cofactors

  • B strains (e.g., BL21):

    • Advantages: Higher biomass yields, reduced acetate formation

    • Limitations: May exhibit inefficient maturation of complex metalloenzymes

  • Specialized strains:

    • Rossetta strains: Enhance expression by providing rare codons

    • SHuffle strains: Facilitate disulfide bond formation in the cytoplasm

Importantly, even metabolically deficient strains like E. coli BL21 can be engineered to produce active metalloenzymes through co-expression of specific maturation genes and process optimization. This indicates that strain limitations can be overcome with appropriate genetic and process engineering approaches .

What troubleshooting approaches address low activity in recombinant hydrogenase preparations?

When facing low hydrogenase activity, systematic troubleshooting approaches include:

  • Cofactor incorporation assessment:

    • Spectroscopic analysis (IR, EPR) to confirm metal center assembly

    • Metal content quantification via ICP-MS

  • Expression system optimization:

    • Verify co-expression of all required maturases

    • Confirm appropriate ratios of hydrogenase structural genes and maturation factors

    • Test different promoter systems to balance expression timing

  • Growth condition refinement:

    • Adjust metal supplementation concentration and timing

    • Optimize oxygen supply through cultivation system design

    • Test temperature reduction during expression phase

  • Protein folding improvement:

    • Co-express molecular chaperones

    • Implement temperature downshift strategies

    • Consider periplasmic or membrane targeting for appropriate components

Each parameter should be systematically tested while monitoring both protein yield and specific activity to identify optimal conditions .

What spectroscopic techniques are most informative for characterizing the structure and activity of recombinant hydrogenases?

Multiple complementary spectroscopic techniques provide comprehensive structural and functional insights:

  • Infrared (IR) spectroscopy:

    • Identifies characteristic CO and CN⁻ ligands of the [NiFe] center

    • Distinguishes different catalytic states based on frequency shifts

    • Provides direct evidence of proper cofactor incorporation

  • Electron Paramagnetic Resonance (EPR):

    • Detects paramagnetic species in the enzyme

    • Identifies different redox states of the [NiFe] center

    • Confirms proper electronic structure of the active site

  • X-ray Absorption Spectroscopy (XAS):

    • Provides detailed information about metal coordination environments

    • Distinguishes between properly and improperly assembled metal centers

  • Resonance Raman spectroscopy:

    • Characterizes metal-ligand vibrations

    • Provides complementary information to IR on metal center structure

These techniques collectively confirm successful incorporation of the NiFe(CN)₂CO cofactor and assembly of Fe-S clusters in properly matured hydrogenases .

How can the oxygen tolerance of recombinant Ni/Fe-hydrogenases be accurately assessed and potentially enhanced?

Methodological approaches to assess and enhance oxygen tolerance include:

  • Standardized activity assays:

    • Measure enzyme activity under controlled oxygen concentrations

    • Determine inactivation kinetics at various oxygen levels

    • Assess recovery rates after oxygen exposure

  • Molecular determinants of oxygen tolerance:

    • Identify structural features contributing to oxygen tolerance (e.g., additional Fe-S clusters)

    • Evaluate the influence of specific amino acid residues through targeted mutagenesis

    • Study the impact of proximal and distal Fe-S cluster modifications

  • Enhancement strategies:

    • Engineer gas channels to restrict oxygen access to the active site

    • Introduce additional electron transfer pathways to facilitate reactivation

    • Modify the redox properties of accessory clusters

The O₂-tolerant hydrogenases from Cupriavidus necator represent valuable model systems, as they maintain catalytic activity even in the presence of molecular oxygen, making them particularly interesting for biotechnological applications that cannot maintain strict anaerobic conditions .

What computational models best predict the electron transfer pathways involving the hyaC subunit in hydrogenase complexes?

Advanced computational approaches for modeling electron transfer in hydrogenase complexes:

  • Density Functional Theory (DFT):

    • Calculates electronic structures of metal centers and redox-active residues

    • Predicts redox potentials of electron transfer components

  • Molecular Dynamics (MD) simulations:

    • Models dynamic interactions between subunits, including hyaC

    • Identifies transient conformational changes that facilitate electron transfer

  • Brownian Dynamics:

    • Calculates electron tunneling pathways between redox centers

    • Predicts electron transfer rates based on distance and protein medium

  • Quantum Mechanics/Molecular Mechanics (QM/MM):

    • Models electronic structure of cofactors embedded in protein environment

    • Accounts for protein effects on electron transfer properties

These computational approaches, when integrated with experimental data from spectroscopic techniques, provide comprehensive models of electron transfer pathways and identify rate-limiting steps in catalysis. For membrane-associated components like hyaC, proper modeling of the membrane environment is essential for accurate prediction of electron transfer properties.

How does the heterologous expression of hyaC compare between different expression hosts beyond E. coli?

Comparative analysis of heterologous expression systems reveals distinct advantages and limitations:

Expression HostAdvantagesLimitationsRelative Yield
E. coliRapid growth, well-characterized genetics, established toolboxChallenges with membrane protein expression, limited post-translational modificationsHigh (up to 80-250 mg/L)
Yeast (S. cerevisiae)Eukaryotic processing, good for membrane proteinsSlower growth, different codon usageModerate
C. necator (native host)Natural maturation systemSlow growth, limited genetic toolsLow (<1 mg/L)
Cell-free systemsEliminates viability constraints, direct access to reaction environmentScalability challenges, costVariable

What methodological approaches can distinguish between direct and indirect effects when engineering hydrogenase expression systems?

Rigorous experimental design to distinguish direct from indirect effects includes:

  • Systematic genetic controls:

    • Individual gene deletion/complementation experiments

    • Construction of minimal synthetic operons containing only essential genes

    • Application of inducible/repressible systems for conditional expression

  • Temporal analysis:

    • Time-course studies correlating gene expression with protein production

    • Pulse-chase experiments to track protein maturation kinetics

    • Real-time monitoring of metabolic parameters during expression

  • Multi-omics integration:

    • Transcriptomics to identify regulatory networks affected by expression

    • Proteomics to quantify changes in cellular protein composition

    • Metabolomics to detect metabolic adaptations during expression

  • Cellular response characterization:

    • Microscopic examination of morphological changes (e.g., filamentation)

    • Assessment of stress response activation

    • Measurement of growth parameters and viability

This approach has revealed that co-expression of cell division proteins (ftsA/ftsZ) directly counters the filamentation phenotype caused by recombinant protein overproduction, demonstrating a specific mechanism rather than a general stress response .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.