Recombinant Escherichia coli Nitrite transporter NirC (nirC)

Shipped with Ice Packs
In Stock

Description

Introduction to Nitrite Transporter NirC

The nirC gene in Escherichia coli encodes a specialized membrane protein responsible for nitrite transport across the bacterial cell membrane. Located in the nir operon, which codes for a NADH-dependent nitrite reductase, NirC functions primarily to import nitrite as a substrate for the nitrite reductase enzyme . Unlike related transporters that handle both nitrate and nitrite, NirC is specifically dedicated to nitrite transport, making it a distinct player in bacterial nitrogen metabolism .

Recombinant NirC refers to the artificially produced version of this protein, typically expressed in laboratory settings using genetic engineering techniques for research or commercial purposes. These recombinant proteins maintain the essential structural and functional characteristics of the native protein while allowing for controlled production, purification, and modification.

Structure and Biochemical Properties

NirC is a polytopic membrane protein situated in the inner membrane of E. coli cells . The protein consists of 268 amino acids encoded by a gene of 807 base pairs . Structurally, NirC belongs to the formate-nitrite transporter (FNT) family, characterized by its ability to facilitate the movement of small anionic molecules across biological membranes.

The three-dimensional structure of NirC reveals a channel-forming protein that creates a specific pathway for nitrite ions to cross the bacterial membrane. This structural configuration is essential for its selective transport function, allowing it to recognize and transport nitrite while excluding other similar ions.

Protein Identification and Characteristics

ParameterDescription
Gene NamenirC
Protein Size268 amino acids
Gene Length807 base pairs
Accession IDsEG10654 (EcoCyc), b3367, ECK3355, P0AC26 (UniProt)
LocationInner membrane
Primary FunctionTransport of nitrite
FamilyFormate-nitrite transporter (FNT) family

Commercially available recombinant NirC proteins typically have a purity level of 85% or greater, as determined by SDS-PAGE analysis . These products serve as valuable tools for structural studies, antibody production, and functional analyses in laboratory settings.

Biological Function and Mechanism

NirC functions as a specialized channel that facilitates the transport of nitrite (NO₂⁻) across the bacterial cell membrane . This transport mechanism serves two critical biological functions: providing nitrite as a substrate for nitrogen metabolism and contributing to cytoplasmic detoxification by managing potentially harmful nitrite concentrations .

The transport function of NirC becomes particularly significant under anaerobic conditions, where nitrite can serve as an alternative electron acceptor in bacterial respiration. By efficiently transporting nitrite into the cell, NirC enables E. coli to utilize this nitrogen compound as part of its metabolic processes, contributing to bacterial survival in oxygen-limited environments.

Molecular Pathway Interactions

Research has identified important connections between NirC and other molecular pathways. When the nirC gene is deleted, significant changes occur in related regulatory systems. The stress regulator rpoS and its downstream gene csrA become upregulated, while the diguanylate cyclase gene dgcT is downregulated . These alterations lead to decreased concentration of intracellular 3',5'-cyclic diguanosine monophosphate (c-di-GMP) , a critical second messenger that regulates various bacterial behaviors including biofilm formation and motility.

This regulatory pathway suggests a mechanism by which NirC influences bacterial physiology beyond simple nitrite transport. When NirC is absent, environmental nitrite accumulation triggers nitrite stress, which activates the stress regulator RpoS. This activation leads to changes in c-di-GMP synthesis, ultimately affecting crucial bacterial behaviors like biofilm formation and motility .

Role in Pathogenicity and Virulence

The nitrite transporter NirC has emerged as a significant factor in bacterial pathogenicity, particularly in avian pathogenic Escherichia coli (APEC) strains. These strains cause extraintestinal infections in poultry, resulting in substantial economic losses in the poultry industry. Research has demonstrated that NirC influences various aspects of bacterial virulence through multiple mechanisms.

Host-Pathogen Interactions

In Salmonella, NirC has been shown to contribute to pathogenicity by downregulating the production of nitric oxide (NO) by host macrophages . This represents a sophisticated mechanism by which bacteria can modulate host immune responses to enhance their survival. While the evidence for this specific mechanism in E. coli is less definitive, the similarities between these bacterial species suggest comparable functions may exist.

Temporal Pattern of Infection

Time PointWild-Type APECΔnirC Mutant APEC
24 hours post-infectionHigh mortalityLower initial mortality
48 hours post-infectionLimited additional mortalityIncreasing mortality
7 days post-infectionSimilar cumulative mortalitySimilar cumulative mortality but reached gradually

This pattern suggests that NirC affects the kinetics of infection progression rather than the ultimate outcome, pointing to its role in early infection dynamics .

Research Studies on NirC-Deficient Mutants

Multiple studies have examined the effects of nirC gene deletion on bacterial physiology and pathogenicity, providing valuable insights into the protein's biological significance. These investigations have revealed surprisingly complex relationships between NirC function and bacterial behaviors.

Impact on Motility and Biofilm Formation

Contrary to initial expectations, deletion of the nirC gene actually enhances bacterial motility in APEC strains . This increased motility presumably results from the decreased c-di-GMP levels observed in ΔnirC mutants, as c-di-GMP typically acts as a suppressor of bacterial motility.

Conversely, biofilm formation is significantly decreased in NirC-deficient mutants . This reduction aligns with the observed decrease in c-di-GMP levels, as this second messenger normally promotes biofilm development. The altered biofilm formation capability has important implications for bacterial persistence during infection, as biofilms enhance bacterial resistance to host defenses and antimicrobial treatments.

Cellular Adhesion Properties

NirC significantly influences bacterial adhesion to host cells. In experimental models, the cell adhesion ability of ΔnirC strains was approximately half that of wild-type bacteria, both in the presence and absence of alpha-D-mannopyranoside . This reduced adhesion capacity suggests that NirC plays a role in the expression or function of bacterial adhesins, the surface proteins that mediate attachment to host cells.

In studies using mouse brain microvascular endothelial cells (b.End3), NirC-deficient mutants demonstrated markedly reduced ability to adhere to these host cells . This finding highlights NirC's potential importance in infections involving the blood-brain barrier, such as bacterial meningitis.

Tissue Colonization Dynamics

Tissue24 Hours Post-Infection48 Hours Post-Infection
SpleenSimilar counts between WT and ΔnirCHigher counts in ΔnirC
LungSimilar counts between WT and ΔnirCHigher counts in ΔnirC
LiverSimilar counts between WT and ΔnirCHigher counts in ΔnirC
Macrophages (3 hpi)Similar counts between WT and ΔnirCNot applicable
Macrophages (16 hpi)Not applicableHigher counts in ΔnirC

These tissue colonization dynamics reveal a complex pattern where NirC-deficient bacteria initially colonize tissues at rates similar to wild-type bacteria but subsequently demonstrate enhanced proliferation or persistence . This pattern suggests that NirC may influence bacterial adaptation to host environments over time, potentially through effects on stress responses or metabolic adaptations.

Recombinant NirC Production and Applications

Recombinant NirC proteins are produced using genetic engineering techniques, typically in E. coli expression systems. These recombinant proteins serve various research and commercial purposes, including structural studies, antibody production, and functional analyses.

Commercial preparations of recombinant NirC typically achieve purity levels of 85% or greater, as determined by SDS-PAGE analysis . These purified proteins enable detailed biochemical and structural studies that would be difficult to conduct with native membrane proteins isolated directly from bacterial cells.

The production of recombinant NirC typically involves:

  1. Cloning the nirC gene into an expression vector

  2. Transforming the construct into a suitable host strain

  3. Inducing protein expression under controlled conditions

  4. Extracting and purifying the recombinant protein using chromatographic techniques

  5. Verifying protein identity and purity through analytical methods

Research applications of recombinant NirC include:

  • Structure-function studies to identify critical protein domains

  • Development of inhibitors that could target bacterial nitrite transport

  • Production of antibodies for detection and localization studies

  • Analysis of protein-protein interactions with other bacterial or host proteins

Comparison with Other Nitrite/Nitrate Transporters

E. coli possesses multiple transport systems for nitrogen compounds, with NirC being specifically dedicated to nitrite transport. In contrast, related transporters like NarK and NarU demonstrate broader specificity, handling both nitrate and nitrite . This specialization of NirC suggests evolutionary adaptation for efficient management of nitrite, which can be both a metabolic resource and a potential toxin.

During exponential growth, NarK is approximately 100 times more abundant than NarU in membrane fractions, though this ratio changes to about 10:1 during stationary phase . The relative abundance of NirC compared to these transporters is not explicitly stated in the available research, but its specialized function highlights its distinct role in bacterial physiology.

Functional studies suggest that NarK might operate as a primary nitrate-nitrite antiporter . After nitrate is imported and reduced to nitrite, some nitrite is expelled from the cell and then reimported for reduction to ammonia, likely involving NirC in this reimportation step. This interdependence of different nitrogen transport systems points to a coordinated network for nitrogen compound management.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be finalized during production. If you have a preferred tag type, please inform us and we will prioritize its implementation.
Synonyms
nirC; b3367; JW3330; Nitrite transporter NirC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
nirC
Target Protein Sequence
MFTDTINKCAANAARIARLSANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLVMGATFGIALTLVIIAGSELFTGHTMFLTFGVKAGSISHGQMWAILPQTWLGNLVGSVFVAMLYSWGGGSLLPVDTSIVHSVALAKTTAPAMVLFFKGALCNWLVCLAIWMALRTEGAAKFIAIWWCLLAFIASGYEHSIANMTLFALSWFGNHSEAYTLAGIGHNLLWVTLGNTLSGAVFMGLGYWYATPKANRPVADKFNQTETAAG
Uniprot No.

Target Background

Function
The enzyme catalyzes nitrite uptake and export across the cytoplasmic membrane. It exhibits up to 10-fold higher activity compared to NarK or NarU in nitrite uptake, facilitating subsequent reduction in the cytoplasm by the NirB/NirD nitrite reductase.
Gene References Into Functions
  1. A NarU+ NirC+ strain demonstrated accelerated growth and nitrite accumulation compared to the isogenic NarU+ NirC(-) strain. Only the NirC+ strain efficiently consumed nitrite during the later stages of growth. PMID: 18691156
Database Links
Protein Families
FNT transporter (TC 2.A.44) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the NirC protein and what is its physiological role in E. coli?

NirC is a membrane protein belonging to the formate/nitrite transporter (FNT) family (transporter class 2.A.44) that functions primarily as a nitrite channel in enteric bacteria. In Escherichia coli and Salmonella typhimurium, NirC is encoded by the third gene of the nirBDCcysG operon. The primary physiological role of NirC is to import nitrite from the periplasm into the cytoplasm, where it can be reduced by the cytoplasmic nitrite reductase NirBD. Electrophysiological studies have confirmed that NirC acts as a voltage-independent specific channel for nitrite anions. While it can transport both nitrite and formate, it shows approximately 30% higher permeability for nitrite compared to formate, which is its physiological cargo .

How is NirC expression regulated in E. coli?

NirC expression in E. coli is regulated by three key transcription factors:

  • FNR (Fumarate and Nitrate Reductase) - activated under anoxic conditions

  • NarL - stimulated by nitrate

  • NarP - stimulated by both nitrate and nitrite

This regulatory network ensures that NirC is expressed under appropriate environmental conditions, particularly in anoxic environments where nitrate/nitrite respiration becomes important for bacterial metabolism .

What are the key considerations for optimizing recombinant NirC expression in E. coli?

Optimizing recombinant NirC expression requires attention to several factors:

  • N-terminal sequence optimization: The nucleotides immediately following the start codon significantly influence protein expression levels. Using directed evolution-based methodologies to screen large libraries of diversified N-terminal sequences can substantially increase expression levels.

  • Fusion tags: Consider C-terminal GFP fusion for monitoring expression levels and facilitating fluorescence-activated cell sorting (FACS) to identify high-expressing clones.

  • Expression vector selection: Choose vectors with appropriate promoters and ribosome binding sites compatible with membrane protein expression.

  • Host strain selection: Select E. coli strains optimized for membrane protein expression.

  • Induction conditions: Optimize temperature, inducer concentration, and induction timing to maximize yield of properly folded protein.

Implementing a directed evolution approach with FACS-based selection of N-terminal coding sequences has been shown to increase soluble protein yields by up to 30-fold for various recombinant proteins .

How can I monitor and assess NirC expression and functionality in recombinant systems?

Monitoring recombinant NirC expression and functionality can be accomplished through multiple approaches:

Expression monitoring:

  • GFP fusion for fluorescence-based detection and quantification

  • Western blotting with anti-NirC or anti-tag antibodies

  • Mass spectrometry for protein identification and quantification

Functionality assessment:

  • Liposome reconstitution: Reconstitute purified NirC into liposomes and measure nitrite transport using fluorescent probes or radioactive tracers.

  • Electrophysiology: Perform patch-clamp recordings on proteoliposomes or planar lipid bilayers containing NirC to measure channel conductance and ion selectivity.

  • Complementation assays: Transform NirC-deficient E. coli strains with the recombinant NirC and assess growth under nitrite-dependent conditions.

For electrophysiological assessment, single-channel currents can be determined at asymmetric nitrite concentrations (e.g., 20 mM/100 mM) across different holding potentials to confirm channel functionality .

How should I design experiments to investigate NirC structure-function relationships?

When investigating NirC structure-function relationships, follow these experimental design principles:

  • Define your variables clearly:

    • Independent variables: Mutations/modifications to NirC sequence, expression conditions

    • Dependent variables: Protein expression level, solubility, transport activity, substrate specificity

    • Control variables: Expression system, purification method, measurement conditions

  • Formulate specific, testable hypotheses about how structural changes affect function

  • Design systematic mutagenesis strategies:

    • Alanine-scanning mutagenesis of conserved residues

    • Domain swapping with related transporters

    • Site-directed mutagenesis of putative substrate binding sites

  • Implement appropriate controls:

    • Wild-type NirC as positive control

    • Empty vector as negative control

    • Related transporters (e.g., FocA) for specificity comparisons

  • Plan robust measurement methods for both expression and function

What approaches can be used to investigate NirC selectivity between nitrite and formate?

To investigate NirC selectivity between nitrite and formate, consider these methodological approaches:

  • Bi-ionic potential measurements: Assess reversal potential shifts under bi-ionic conditions (presence of both formate and nitrite) to calculate relative permeabilities.

  • Competition assays: Measure nitrite transport in the presence of varying formate concentrations to determine competitive inhibition constants.

  • Site-directed mutagenesis: Modify putative selectivity filter residues based on structural comparisons with FocA (which has opposite selectivity preference) and measure changes in substrate preference.

  • Structural studies: Use X-ray crystallography or cryo-EM to determine NirC structure in the presence of different substrates.

Electrophysiological studies have shown that while NirC can transport both anions, it exhibits approximately 30% higher permeability for nitrite compared to formate. This is the opposite pattern observed in FocA, where nitrite passes with only 70% of the permeability for formate .

How can directed evolution approaches be applied to engineer NirC for enhanced properties?

Directed evolution can be applied to engineer NirC for enhanced properties through this methodological workflow:

  • Library generation:

    • Create diverse NirC variant libraries using error-prone PCR, DNA shuffling, or targeted mutagenesis of N-terminal sequences

    • Clone libraries into expression vectors with C-terminal GFP fusion to enable fluorescence-based screening

  • High-throughput screening:

    • Transform libraries into appropriate E. coli strains

    • Use FACS to isolate cells with increased fluorescence, indicating higher expression levels

    • For functional screening, develop nitrite-responsive fluorescent assays

  • Iterative selection:

    • Recover DNA from high-performing variants

    • Subject to further rounds of mutagenesis and selection

    • Combine beneficial mutations through DNA shuffling

  • Characterization and validation:

    • Analyze sequence changes in improved variants

    • Perform detailed functional characterization

    • Validate improvements in different expression conditions

This approach has demonstrated success in increasing soluble recombinant protein yields by up to 30-fold in E. coli through optimization of N-terminal coding sequences .

What are the key regulatory considerations for research involving recombinant NirC in E. coli?

Research involving recombinant NirC in E. coli must adhere to established regulatory frameworks:

  • NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules:

    • Compliance is mandatory for institutions receiving NIH funding

    • Experiments must be registered through appropriate institutional biosafety channels

    • Some experiments may require Institutional Biosafety Committee (IBC) approval prior to initiation

  • Risk assessment considerations:

    • NirC's role in nitrite transport relates to bacterial adaptation to anaerobic environments

    • Assess potential impacts on bacterial pathogenicity or survival

    • Consider whether engineered NirC could confer selective advantages

  • Documentation requirements:

    • Maintain detailed records of cloning strategies, host strains, and experimental designs

    • Document biosafety containment measures appropriate to the risk assessment

  • Specific approval requirements:

    • Deliberate transfer of drug resistance traits would require NIH Director and IBC approval prior to initiation

    • Cloning of toxin molecules with low LD₅₀ values also requires special approval

What strategies can address poor solubility of recombinant NirC?

Membrane proteins like NirC often present solubility challenges. These methodological approaches can help:

  • Fusion partners:

    • Thioredoxin A (TrxA) fusion to enhance solubility

    • Glutathione S-transferase (GST) for improved solubility and affinity purification

    • Maltose-binding protein (MBP) to enhance folding and solubility

  • N-terminal sequence optimization:

    • Screen N-terminal coding DNA libraries using FACS-based selection

    • Optimize the first 10-15 codons following the start codon to enhance translation efficiency

  • Expression conditions optimization:

    • Lower induction temperature (16-25°C)

    • Reduce inducer concentration

    • Use specialized E. coli strains designed for membrane protein expression

  • Detergent screening:

    • Systematically test different detergents for extraction and purification

    • Consider mild detergents like DDM, LMNG, or CHAPS

  • Lipid supplementation:

    • Add specific lipids during purification to maintain protein stability

    • Consider nanodiscs or other lipid-based systems for functional studies

The FACS-based selection of N-terminal coding sequences has demonstrated success in increasing soluble protein yields up to 30-fold for challenging recombinant proteins .

How can I distinguish between functional properties of recombinant NirC versus endogenous nitrite transporters?

Distinguishing recombinant NirC function from endogenous transporters requires careful experimental design:

  • Genetic approaches:

    • Use NirC knockout strains as expression hosts

    • Create strains with knockouts of multiple nitrite transporters (NirC, NarK, NarU)

    • Complement knockout strains with modified NirC variants

  • Biochemical discrimination:

    • Incorporate affinity or epitope tags for selective purification/detection

    • Use site-directed mutagenesis to introduce specific inhibitor sensitivity

    • Develop NirC-specific antibodies for immunological detection

  • Functional discrimination:

    • Compare transport kinetics with published values for endogenous transporters

    • Assess substrate specificity profiles (e.g., nitrite:formate permeability ratio of approximately 1.3:1 for NirC)

    • Measure response to specific inhibitors

  • Heterologous expression:

    • Express NirC in organisms lacking nitrite transport systems

    • Use eukaryotic expression systems where bacterial transporters are absent

What are the emerging applications of engineered NirC in synthetic biology?

Engineered NirC has several potential applications in synthetic biology:

  • Nitrite biosensors:

    • Development of whole-cell biosensors for environmental nitrite detection

    • Creation of nitrite-responsive genetic circuits using NirC-mediated nitrite sensing

  • Metabolic engineering:

    • Enhancing nitrite uptake for improved nitrogen metabolism in engineered strains

    • Incorporating NirC into synthetic pathways for nitrite utilization

  • Protein engineering platforms:

    • Using NirC as a model system for membrane protein engineering

    • Developing novel directed evolution approaches for membrane transporters

  • Bioremediation applications:

    • Engineering bacteria with enhanced nitrite uptake for nitrite-contaminated water treatment

    • Developing co-cultures with complementary nitrogen metabolism capabilities

  • Fundamental membrane protein research:

    • Using NirC as a model system to explore membrane protein folding and assembly

    • Investigating the evolutionary relationships within the FNT family

How do expression levels and functionality of recombinant NirC compare across different E. coli strains?

When comparing NirC expression across E. coli strains, consider these methodological approaches:

  • Systematic strain comparison:

    • Test expression in common laboratory strains (BL21(DE3), C41(DE3), C43(DE3), etc.)

    • Compare with specialized membrane protein expression strains

    • Assess strains with different protease profiles and chaperone levels

  • Quantitative assessment methods:

    • Western blotting with standard curves for quantification

    • Flow cytometry analysis of GFP-fused constructs

    • Mass spectrometry-based quantification

  • Functionality assessment across strains:

    • Nitrite uptake assays in whole cells

    • Membrane vesicle transport assays

    • Complementation of NirC-deficient phenotypes

This comparative data can be presented in a table format:

E. coli StrainExpression LevelSoluble FractionTransport ActivityNotes
BL21(DE3)++++++High expression but low solubility
C41(DE3)+++++++Balanced expression and solubility
C43(DE3)++++++++Optimized for membrane proteins
Lemo21(DE3)++++++++Tunable expression system
Rosetta(DE3)+++++Supplies rare tRNAs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.