Recombinant Escherichia coli Probable phospholipid ABC transporter permease protein mlaE (mlaE)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant MlaE refers to the engineered form of the MlaE protein produced via heterologous expression systems in E. coli. MlaE is the transmembrane permease subunit of the MlaFEDB ABC transporter, which is part of the Maintenance of Lipid Asymmetry (Mla) pathway. This pathway ensures retrograde transport of phospholipids (PLs) from the OM to the inner membrane (IM), preserving OM impermeability .

Functional Role in Phospholipid Transport

MlaE facilitates PL transport via ATP hydrolysis-driven conformational changes:

  • Directionality: Controversial—reports suggest both retrograde (OM→IM) and anterograde (IM→OM) transport .

  • Substrate Specificity: Binds phosphatidylethanolamine (PE), phosphatidylglycerol (PG), and cardiolipin .

  • Coordination: Works with MlaC (periplasmic chaperone) and MlaA-OmpC/F (OM complex) .

4.1. Genetic and Biochemical Insights

  • Deletion of mlaE disrupts OM integrity, increasing antibiotic sensitivity .

  • MlaE’s transmembrane helices form a hydrophobic cavity critical for lipid extraction from the IM .

4.2. Transport Mechanism

  • ATP binding by MlaF induces conformational shifts in MlaE, opening the periplasmic channel .

  • Two lipid-binding sites in MlaFEDB suggest simultaneous transport of diverse PLs .

4.3. Recombinant Expression Systems

While no direct studies on recombinant MlaE production exist, E. coli BL21(DE3) is the standard host for ABC transporter expression . Key optimizations include:

  • Vector Design: T7 promoter systems with lac operon repression .

  • Secretion: Signal peptides (e.g., PelB-Nat) enhance periplasmic localization .

Biotechnological Relevance

MlaE’s role in OM homeostasis has implications for:

  • Antibiotic Development: Targeting MlaE could disrupt OM integrity in multidrug-resistant pathogens .

  • Synthetic Biology: Engineered Mla systems may enable lipid trafficking in artificial membranes.

Unresolved Questions

  • Transport Direction: Conflicting evidence on import vs. export roles .

  • Regulatory Mechanisms: Role of MlaB (STAS domain protein) in modulating ATPase activity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. For dry ice shipping, please inform us in advance and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a reference point for customers.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
mlaE; yrbE; b3194; JW3161; Intermembrane phospholipid transport system permease protein MlaE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
mlaE
Target Protein Sequence
MLLNALASLGHKGIKTLRTFGRAGLMLFNALVGKPEFRKHAPLLVRQLYNVGVLSMLIIV VSGVFIGMVLGLQGYLVLTTYSAETSLGMLVALSLLRELGPVVAALLFAGRAGSALTAEI GLMRATEQLSSMEMMAVDPLRRVISPRFWAGVISLPLLTVIFVAVGIWGGSLVGVSWKGI DSGFFWSAMQNAVDWRMDLVNCLIKSVVFAITVTWISLFNGYDAIPTSAGISRATTRTVV HSSLAVLGLDFVLTALMFGN
Uniprot No.

Target Background

Function
The mlaE protein is part of the ABC transporter complex MlaFEDB, which is involved in a phospholipid transport pathway. This pathway maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane. The mlaE protein is likely responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
MlaE permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MlaE protein and what is its role in bacterial membrane systems?

MlaE functions as the transmembrane subunit of the MlaFEDB complex, an ABC transporter located in the inner membrane of Gram-negative bacteria such as Escherichia coli. This protein has minimal sequence similarity to other transporters, suggesting unique structural and functional properties . The entire Mla system plays a crucial role in phospholipid trafficking between the inner membrane (IM) and outer membrane (OM), which is essential for maintaining the outer membrane barrier that contributes to virulence and antibiotic resistance mechanisms .

The MlaE subunit forms a substrate-binding site that creates part of a continuous transport pathway extending through the MlaD channel into the periplasm . This pathway enables the controlled movement of phospholipids across the cell envelope, supporting proper membrane composition and integrity. Unlike many other membrane transporters, MlaE demonstrates distinctive structural characteristics that make it an interesting subject for research into novel transport mechanisms.

How does the MlaE protein integrate with the complete Mla transport system?

The Mla phospholipid transport system consists of three main components that work in concert to maintain membrane homeostasis:

  • An inner membrane ABC transporter complex (MlaFEDB)

  • An outer membrane complex (MlaA-OmpC/F)

  • A soluble periplasmic protein (MlaC)

Within this system, MlaE serves as the core transmembrane component of the inner membrane complex. The MlaC protein has been proposed to function as a shuttle, transferring phospholipids between the inner membrane MlaFEDB complex and the outer membrane MlaA-OmpC/F complex . This coordinated transport system ensures proper phospholipid distribution across the bacterial cell envelope.

The following table summarizes the components of the Mla system and their functions:

ComponentLocationFunction
MlaEInner membraneTransmembrane permease subunit with substrate binding site
MlaFInner membraneATP-binding cassette protein providing energy for transport
MlaDInner membrane/periplasmicForms channel connecting to periplasm
MlaBInner membraneAccessory protein of the ABC transporter complex
MlaCPeriplasmSoluble shuttle protein for phospholipid transfer
MlaAOuter membraneOuter membrane component complexed with OmpC/F

What structural information is available for the MlaE protein?

Recent cryo-electron microscopy studies have successfully determined the structure of the entire MlaFEDB complex at 3.05 Å resolution . These structural analyses revealed that the MlaFEDB complex, including the MlaE component, shows distant relationships to LPS and MacAB transporters, as well as to the eukaryotic ABCA/ABCG families of transporters .

A continuous transport pathway was identified extending from the MlaE substrate-binding site, through the channel formed by MlaD, and into the periplasm . Perhaps most interestingly, structural studies unexpectedly revealed that two phospholipids are bound to the MlaFEDB complex, suggesting that multiple lipid substrates may be transported during each transport cycle . This finding provides significant insights into the potential mechanism of phospholipid transport by this system.

How can researchers address potential confounding variables when studying MlaE function?

When designing experiments to study MlaE function, researchers must carefully control for confounding variables that could lead to misinterpretation of results. Simpson's paradox, an extreme condition of confounding where apparent associations between variables can be reversed when data are analyzed differently, illustrates the importance of proper experimental design .

For Simpson's paradox to occur, two conditions must be present: (a) an ignored or overlooked confounding variable with a strong effect on the outcome variable; and (b) a disproportionate distribution of the confounding variable among the groups being compared . When studying membrane proteins like MlaE, potential confounding variables might include:

  • Membrane composition differences between experimental conditions

  • Variations in expression levels of other Mla system components

  • Changes in cell physiology due to experimental manipulations

To control for these variables, researchers should consider employing randomized block designs or minimization techniques that balance groups on potentially confounding factors . As one source notes, "Simpson's paradox could not arise if the groups are equivalent on the confounding variable" . Thus, designs generating balanced group sample sizes should be selected and appropriate statistical control procedures applied.

What experimental approaches are most effective for investigating MlaE-mediated phospholipid transport?

Investigating the mechanism of phospholipid transport mediated by MlaE requires a multi-faceted experimental approach. Based on current research methodologies, the following approaches would be most effective:

  • Structural biology techniques: Building on the successful cryo-EM structure determination of MlaFEDB , researchers can employ additional structural biology methods to capture different conformational states of the transporter during the transport cycle.

  • Biochemical reconstitution assays: Purified MlaFEDB complexes can be reconstituted into liposomes or nanodiscs to study transport activity in a controlled membrane environment.

  • Genetic approaches: Site-directed mutagenesis of key residues in MlaE identified from structural studies can help determine their role in substrate binding and transport.

  • Molecular dynamics simulations: Computational approaches can provide insights into the dynamics of phospholipid movement through the MlaE transport pathway.

The following table summarizes these approaches and their applications:

ApproachTechniquesApplicationsAdvantages
Structural BiologyCryo-EM, X-ray crystallographyDetermining protein structure and conformational statesProvides atomic-level details of transport mechanism
Biochemical ReconstitutionLiposome/nanodisc reconstitution, transport assaysMeasuring transport activity in vitroControlled environment for functional studies
Genetic ApproachesSite-directed mutagenesis, gene knockoutsIdentifying functional residues and domainsLinks structure to function in vivo
Computational MethodsMolecular dynamics simulationsModeling substrate binding and transportInsights into dynamic processes difficult to capture experimentally

How might alterations in MlaE expression affect bacterial virulence and antibiotic resistance?

The Mla system plays a key role in maintaining the outer membrane barrier of Gram-negative bacteria, which directly impacts virulence and antibiotic resistance . Alterations in MlaE expression or function could therefore have significant consequences for bacterial pathogenicity and treatment options.

Reduced MlaE function might lead to:

  • Altered phospholipid distribution in the outer membrane

  • Compromised membrane integrity and barrier function

  • Increased sensitivity to certain antibiotics that target the cell envelope

  • Potential changes in the expression of virulence factors regulated by membrane stress responses

What expression systems are recommended for producing recombinant MlaE protein?

When selecting an expression system for producing recombinant MlaE protein, researchers must consider several factors including proper protein folding, membrane insertion, and yield. Based on research with similar membrane proteins and recombinant protein production strategies, the following expression systems merit consideration:

Escherichia coli-based systems: E. coli expression systems offer economic advantages with potential for high-yield production . For membrane proteins like MlaE, specialized E. coli strains (C41(DE3), C43(DE3), or Lemo21(DE3)) designed for membrane protein expression may improve results. A potential drawback of E. coli systems is that some membrane proteins may not fold properly or insert correctly into membranes.

Cell-free expression systems: These allow direct synthesis of membrane proteins in the presence of detergents or lipid environments, potentially improving proper folding. While potentially offering better control over the expression environment, these systems typically yield lower protein amounts than cellular systems.

Alternative host systems: Yeast (Pichia pastoris, Saccharomyces cerevisiae) or insect cell (Sf9, Hi5) expression systems may provide improved folding and processing for complex membrane proteins, though with increased technical complexity and cost.

The following table compares these expression systems:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coli standard strainsEconomic, high yield potential, simple protocolsMay form inclusion bodies, limited post-translational modificationsInitial expression trials, robust membrane proteins
E. coli specialized strainsBetter for toxic or membrane proteins, reduced aggregationStill limited in post-translational modificationsChallenging membrane proteins like MlaE
Cell-free systemsDirect synthesis in membrane mimetics, rapidLower yields, costlyDifficult-to-express membrane proteins, rapid screening
Yeast systemsEukaryotic folding machinery, scalableLonger timeframe, different membrane compositionComplex membrane proteins requiring specific folding
Insect cell systemsAdvanced folding machinery, native-like membranesHigher cost, technical complexityHigh-value targets requiring optimal folding

What purification strategies are most effective for isolating functional MlaE protein?

Purifying membrane proteins like MlaE presents significant challenges due to their hydrophobic nature and requirement for a lipid environment to maintain structure and function. A successful purification strategy would likely include the following steps:

  • Membrane isolation and solubilization: Carefully isolate bacterial membranes and solubilize using detergents that maintain protein structure and function. For ABC transporters like MlaFEDB, mild detergents such as n-dodecyl-β-D-maltopyranoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are often effective.

  • Affinity chromatography: Using a tagged version of MlaE or one of its partner proteins to facilitate purification. Polyhistidine tags are commonly used, though consideration must be given to tag placement to avoid interference with function.

  • Size exclusion chromatography: To separate the intact MlaFEDB complex from aggregates or incomplete complexes, and to achieve buffer exchange if needed.

  • Stability assessment: Monitor protein stability throughout the purification process using techniques such as size exclusion chromatography with multi-angle light scattering (SEC-MALS) or thermal shift assays.

The successful structural determination of MlaFEDB at 3.05 Å resolution demonstrates that effective purification protocols exist, though the specific details were not provided in the search results.

How can researchers effectively validate the functionality of purified MlaE protein?

To ensure that purified MlaE protein (or the MlaFEDB complex) remains functionally active following expression and purification, researchers should employ multiple complementary approaches:

  • ATP hydrolysis assays: Since MlaFEDB is an ABC transporter, measuring ATP hydrolysis rates can provide an indication of enzymatic activity. This can be done using colorimetric phosphate detection methods or coupled enzyme assays.

  • Lipid binding assays: The observation that MlaFEDB binds two phospholipids suggests that lipid binding assays could be valuable for assessing functionality. Techniques such as isothermal titration calorimetry (ITC) or fluorescence-based assays with labeled lipids can be employed.

  • Reconstitution transport assays: Reconstituting the purified protein into liposomes and measuring transport of labeled phospholipids provides the most direct assessment of functional activity.

  • Structural integrity verification: Techniques such as circular dichroism (CD) spectroscopy or limited proteolysis can assess whether the purified protein maintains its proper folding.

The following table summarizes these validation approaches:

Validation ApproachTechniqueMeasuresConsiderations
ATP HydrolysisMalachite green assay, Coupled enzyme assayATPase activityMay not directly correlate with transport function
Lipid BindingITC, Fluorescence-based assays, MSTSubstrate bindingBinding doesn't guarantee transport functionality
Transport AssaysReconstitution into liposomes with fluorescent/radiolabeled lipidsActual transport activityMost direct measure of function but technically challenging
Structural IntegrityCD spectroscopy, Limited proteolysis, Thermal shift assaysProtein folding and stabilityProvides supporting evidence of proper structure

How can researchers enhance trustworthiness in qualitative analyses of MlaE studies?

When conducting qualitative analyses in MlaE research, incorporating tables can significantly enhance the trustworthiness of findings. Tables serve three key functions: (1) they organize and condense data, (2) they allow analysis from various perspectives, and (3) they help display evidence and findings in a succinct and convincing manner .

For MlaE-related studies, researchers might consider the following table types:

  • Data sources tables: Documenting all data sources by type, including their description, quantity, and how they contribute to the findings . This provides transparency about the scope and depth of the research.

  • Concept-evidence tables: Listing concepts with selected evidence, descriptions, properties, and triangulated sources . This approach is particularly useful when analyzing complex phenotypes resulting from MlaE mutations or functional studies.

  • Cross-case analysis tables: Comparing concepts across different experimental conditions or bacterial strains, supported by selected evidence . This can help identify patterns in how MlaE function varies across different genetic backgrounds or environmental conditions.

The use of such tables increases trustworthiness by accounting for the "disciplined pursuit and analysis of data" and helps readers assess important sources of credibility, such as the extent of a researcher's engagement with multiple sources.

What statistical approaches should be considered when analyzing data from MlaE functional studies?

When analyzing data from MlaE functional studies, researchers must carefully consider statistical approaches that account for potential confounding variables. As highlighted in the discussion of Simpson's paradox , data that appears to show one relationship at the aggregate level may reveal different or even opposite relationships when properly stratified.

For MlaE studies, consider the following statistical approaches:

  • Controlling for confounding variables: Identify potential confounding variables (such as bacterial strain background, growth conditions, or expression levels of other Mla components) and either control for them in the experimental design or account for them in the statistical analysis .

  • Appropriate design selection: Choose designs that produce balanced group sample sizes, such as randomized block designs or minimization techniques . This helps prevent the conditions that lead to Simpson's paradox.

  • Interaction analysis: Test for interactions between treatment conditions and strata (subgroups), as interactions would indicate that differences between treatments exist across strata, which would not be revealed in tests of main effects alone .

How should researchers approach the integration of structural and functional data for MlaE protein?

Integrating structural and functional data is essential for a comprehensive understanding of MlaE's role in phospholipid transport. The cryo-EM structure of MlaFEDB at 3.05 Å resolution provides a foundation for functional studies, but relating structure to function requires careful data integration approaches.

Researchers should consider:

  • Structure-guided mutagenesis: Using the structural data to identify residues potentially involved in substrate binding or transport, then testing their functional importance through site-directed mutagenesis and functional assays.

  • Conformational state analysis: Capturing MlaFEDB in different conformational states using techniques like cryo-EM, then correlating these states with specific steps in the transport cycle.

  • Computational modeling: Using molecular dynamics simulations to model phospholipid movement through the identified transport pathway, generating hypotheses that can be tested experimentally.

  • Integrative data visualization: Developing visual representations that combine structural data with functional measurements, allowing for intuitive interpretation of complex relationships.

The unexpected finding that MlaFEDB binds two phospholipids demonstrates how structural studies can reveal functional insights that might not have been anticipated from biochemical studies alone, highlighting the value of this integrative approach.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.