Recombinant Escherichia coli Probable sensor-like histidine kinase YedV (yedV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hprS; yedV; b1968; JW1951; Sensor histidine kinase HprS; Hydrogen peroxide response sensor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yedV
Target Protein Sequence
MKRLSITVRLTLLFILLLSVAGAGIVWTLYNGLASELKWRDDTTLINRTAQIKQLLIDGV NPDTLPVYFNRMMDVSQDILIIHGDSINKIVNRTNVSDGMLNNIPASETISAAGIYRSII NDTEIDALRINIDEVSPSLTVTVAKLASARHNMLEQYKINSIIICIVAIVLCSVLSPLLI RTGLREIKKLSGVTEALNYNDSREPVEVSALPRELKPLGQALNKMHHALVKDFERLSQFA DDLAHELRTPINALLGQNQVTLSQTRSIAEYQKTIAGNIEELENISRLTENILFLARADK NNVLVKLDSLSLNKEVENLLDYLEYLSDEKEICFKVECNQQIFADKILLQRMLSNLIVNA IRYSPEKSRIHITSFLDTNSYLNIDIASPGTKINEPEKLFRRFWRGDNSRHSVGQGLGLS LVKAIAELHGGSATYHYLNKHNVFRITLPQRN
Uniprot No.

Target Background

Function

YedV is a probable sensor-like histidine kinase in Escherichia coli, a member of the two-component regulatory system HprR/HprS involved in the cellular response to hydrogen peroxide. It senses H2O2, potentially via the membrane's redox state, activating HprR through phosphorylation. It also exhibits the capacity to phosphorylate CusR.

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YedV and why was it renamed to HypV?

YedV is a sensor-like histidine kinase that forms part of a two-component signaling system (TCS) in Escherichia coli. Recent research has demonstrated that YedV specifically senses hypochlorous acid (HOCl), leading to its renaming as HypV. According to current literature, "YedV appears to be an HOCl-sensing histidine kinase. Based on this finding, we proposed to rename this system HypVW." This renaming follows the convention in bacterial genetics of naming proteins according to their discovered functions, with the prefix "Hyp" referring to hypochlorous acid detection capability.

What is the function of the HypVW two-component system?

The HypVW system (formerly YedVW) functions as a signaling pathway that allows E. coli to sense and respond to HOCl, a potent oxidant. Research shows that "HypVW has been recently shown to be involved in the regulation of msrPQ, encoding for the periplasmic methionine sulfoxide reductase system." This system plays a crucial role in bacterial defense against oxidative stress, particularly from reactive chlorine species (RCS). HypVW appears to be the first characterized TCS in E. coli specifically dedicated to HOCl detection.

How does HypV differ from other histidine kinases in E. coli?

Unlike other histidine kinases that may respond to various reactive oxygen species (ROS), HypV shows remarkable specificity for HOCl. Research demonstrates that "HOCl induces the expression of msrPQ in a YedVW dependent manner, whereas H₂O₂, NO and paraquat (a superoxide generator) do not." This specificity suggests a dedicated pathway for responding to chlorine-based oxidative stress, distinguishing HypV from other sensor kinases with broader response profiles.

What is known about E. coli as a model organism for studying protein function?

E. coli is one of the most widely used model organisms in molecular biology and has been extensively studied in experimental evolution. The E. coli long-term evolution experiment (LTEE) has been tracking genetic changes in bacterial populations since 1988 and "has been tracking genetic changes in 12 initially identical populations of asexual Escherichia coli bacteria." As of August 2024, the populations in this experiment "passed 80,000 generations in the Barrick lab." This extensive knowledge base about E. coli genetics and physiology makes it an excellent model for studying proteins like HypV.

What are the most common applications of recombinant E. coli in research?

Recombinant E. coli strains are widely used for protein production in research settings. According to research literature, "in 2010, it was reported that the proportion of recombinant genes expressed in E. coli, compared with those expressed in all hosts had remained constant, at roughly 60% per year during the 15 year period." This demonstrates E. coli's continued importance as an expression host, though alternative systems like yeast are gaining popularity for certain applications, particularly for challenging proteins like membrane-associated histidine kinases.

What is the molecular mechanism of HOCl sensing by HypV?

The molecular mechanism of HOCl sensing by HypV appears to involve methionine residues in its periplasmic domain. Research indicates that "Met residues located in the periplasmic loop of HypV (formerly YedV) are important for its activity." HOCl preferentially oxidizes methionine residues, and this modification likely induces conformational changes that activate HypV's kinase function. The study further proposes that "HypV could be activated via the reversible oxidation of its methionine residues, thus conferring to MsrPQ a role in switching HypVW off." This suggests a sophisticated regulatory mechanism where methionine oxidation serves as a molecular switch for HypV activation.

How does the HypVW system interact with the MsrPQ system?

The interaction between HypVW and MsrPQ represents a regulatory circuit for responding to HOCl stress. HypV detects HOCl through its methionine residues, activates HypW through phosphorylation, which then upregulates msrPQ expression. The MsrPQ proteins subsequently repair oxidized proteins by reducing methionine sulfoxide back to methionine. Research suggests that "HypV could be activated via the reversible oxidation of its methionine residues, thus conferring to MsrPQ a role in switching HypVW off." This indicates a potential negative feedback loop where MsrPQ might reduce oxidized methionines in HypV itself, returning the system to its basal state once the stress is resolved.

What is the significance of a Met redox switch in bacterial signaling?

The proposed methionine redox switch in HypV represents an elegant mechanism for directly sensing oxidative stress. Research indicates that "the activation of HypV by HOCl could occur through a Met redox switch." This mechanism allows for specific detection of HOCl and potentially provides a reversible switching system through the action of methionine sulfoxide reductases. Such redox-based signaling mechanisms are increasingly recognized as important in bacterial responses to environmental stresses, offering rapid and specific detection of particular oxidants.

What evolutionary insights can be gained from studying HypV across bacterial species?

Evolutionary analysis of HypV could reveal adaptation patterns to different oxidative stress environments. The E. coli long-term evolution experiment has demonstrated that "Lenski and his colleagues have reported a wide array of phenotypic and genotypic changes in the evolving populations." Similar evolutionary approaches applied to HypV could identify conserved features essential for function versus adaptable regions that might confer species-specific responses to different oxidative stressors. Comparative genomics of HypV homologs across bacterial species would provide insights into the evolution of HOCl sensing mechanisms.

What expression systems are recommended for recombinant HypV production?

For expressing recombinant HypV, researchers should consider both prokaryotic and eukaryotic expression systems:

Expression SystemAdvantagesLimitationsBest For
E. coliNative environment, rapid growth, high yieldsPotential toxicity if overexpressedFunctional studies, mutational analysis
Yeast (S. cerevisiae, P. pastoris)Better for membrane proteins, post-translational modificationsSlower growth than E. coliStructural studies, difficult-to-express constructs
Cell-free systemsRapid production, avoids toxicity issuesLower yields, expensiveInitial screening, toxic proteins

Yeast systems may offer particular advantages as "Several host systems are available for the production of recombinant proteins, ranging from Escherichia coli to mammalian cell-lines. This article highlights the benefits of using yeast, especially for more challenging targets such as membrane proteins." For membrane-associated proteins like HypV, careful optimization of expression conditions is essential regardless of the chosen system.

What approaches are effective for studying HypV activation mechanisms?

Multiple complementary approaches can be used to investigate HypV activation:

  • Site-directed mutagenesis: "Using a site-specific mutagenesis approach, we show that Met residues located in the periplasmic loop of HypV (formerly YedV) are important for its activity." Creating systematic mutations of methionine residues can identify those critical for HOCl sensing.

  • In vitro phosphorylation assays: Measuring autophosphorylation of purified HypV and phosphotransfer to HypW in response to HOCl provides direct evidence of activation.

  • Reporter gene systems: Constructing transcriptional fusions between HypW-regulated promoters and reporter genes allows monitoring pathway activation in vivo.

  • Mass spectrometry: Direct measurement of methionine oxidation states under various conditions provides insight into the molecular events during activation.

  • Structural biology approaches: X-ray crystallography or cryo-EM studies comparing oxidized and reduced HypV conformations can reveal the structural basis of activation.

How should researchers design experiments to study HypV function in oxidative stress response?

Effective experimental designs for studying HypV function include:

  • Genetic approaches:

    • Gene knockout and complementation studies

    • Construction of hypV and hypW deletion strains followed by phenotypic characterization under HOCl stress

    • Epistasis analysis with other oxidative stress response genes

  • Biochemical approaches:

    • In vitro reconstitution of the HypV-HypW phosphotransfer system

    • Comparison of HypV activity with different oxidants to confirm specificity

    • Analysis of HypV oxidation state using redox proteomics

  • Transcriptomic approaches:

    • RNA-seq or microarray analysis comparing gene expression in wild-type versus ΔhypV strains under HOCl stress

    • ChIP-seq to identify genome-wide binding sites of phosphorylated HypW

  • Physiological approaches:

    • Bacterial survival assays under HOCl stress conditions

    • Measurement of oxidative damage markers in the presence/absence of functional HypV

What techniques are useful for investigating HypV-regulated pathways?

Several molecular techniques are valuable for investigating HypV-regulated pathways:

  • qRT-PCR: For targeted validation of expression changes in specific genes like msrPQ following HOCl exposure in wild-type versus ΔhypV strains.

  • Electrophoretic mobility shift assays (EMSA): To demonstrate direct binding of phosphorylated HypW to promoter regions of target genes.

  • Protein-protein interaction studies: Bacterial two-hybrid assays or co-immunoprecipitation to identify proteins interacting with HypV or HypW.

  • Metabolomics: To identify changes in bacterial metabolite profiles during HOCl stress in a HypV-dependent manner.

  • In vivo crosslinking: To capture transient interactions between components of the HypVW signaling pathway.

How can researchers effectively analyze data from HypV studies?

Statistical approaches and data analysis methods are critical for interpreting results from HypV studies:

Analysis MethodApplicationStatistical Considerations
Regression analysisCorrelating HypV activity with environmental parameters"The lagged regression model with concentration of E. coli as the dependent variable and observations of temperature, conductivity and acidity as independent variables..."
Multivariate analysisIdentifying patterns in -omics datasetsCheck for collinearity: "The lagged observations of temperature and conductivity at t-3 are showing significant collinearity (p < 0.05)."
Survival analysisComparing bacterial resistance to HOClLog-rank tests for significance between survival curves
Dose-response modelingCharacterizing HypV activation by different HOCl concentrationsNon-linear regression models with appropriate parameters
Time-series analysisExamining temporal dynamics of HypV-dependent gene expressionAccount for time-dependent correlations

Proper statistical analysis is essential as demonstrated in environmental studies where "interaction was checked by adding an extra term constituting the product of multiplication of two variables to the original model." Similar approaches can be applied to laboratory data on HypV function.

What are common challenges in working with recombinant HypV and how can they be overcome?

Researchers working with HypV may encounter several challenges:

  • Protein solubility: As a membrane-associated protein, HypV may have solubility issues. Consider using detergents, nanodiscs, or membrane mimetics for purification.

  • Maintaining activity: Preserving HypV function during purification requires careful buffer optimization. Including reducing agents may be necessary to maintain methionine residues in their reduced state prior to activation studies.

  • Specificity of activation: Ensuring that activation is specifically due to HOCl rather than other oxidants requires careful experimental controls and potentially the use of specific HOCl scavengers in control reactions.

  • Reproducing physiological conditions: Creating relevant HOCl concentrations that mimic those encountered by bacteria in vivo can be challenging. Standardized methods for generating and measuring HOCl concentrations are essential.

How does E. coli strain background affect HypV studies?

The choice of E. coli strain can significantly impact HypV studies:

  • Laboratory strains vs. clinical isolates: Laboratory-adapted strains like K-12 derivatives may have different HypV regulatory networks compared to clinical or environmental isolates.

  • Genetic background effects: Mutations in genes related to oxidative stress responses may influence HypV function. The E. coli long-term evolution experiment has shown that "Half of the populations have evolved defects in DNA repair that have caused phenotypes marked by elevated mutation rates."

  • Expression strain considerations: For recombinant expression, strains like BL21(DE3) lacking certain proteases may be advantageous, but may not reflect native regulation.

What collaborative approaches can enhance HypV research?

Given the complexity of bacterial stress responses, interdisciplinary collaboration can significantly enhance HypV research:

  • Combining structural biology with molecular genetics: Integrating structural insights with in vivo functional studies provides a more complete understanding of HypV function.

  • Incorporating environmental microbiology: Understanding how environmental factors affect HypV activity in natural settings requires expertise in both molecular mechanisms and environmental science.

  • Computational modeling: Simulating HypV-HypW signaling networks can generate testable hypotheses about system behavior under various conditions.

  • Evolutionary biology perspectives: Analyzing HypV across bacterial species can reveal evolutionary adaptations to different oxidative stress environments.

What are promising areas for future HypV research?

Several exciting research directions could advance our understanding of HypV:

  • Comprehensive regulatory network mapping: Identifying all genes regulated by the HypVW system and their interconnections with other stress response pathways.

  • Structural dynamics during activation: Capturing the conformational changes that occur during HypV activation using techniques like hydrogen-deuterium exchange mass spectrometry or single-molecule FRET.

  • Role in host-pathogen interactions: Investigating how HypV contributes to bacterial survival during host immune responses, particularly neutrophil-generated HOCl.

  • Potential as an antimicrobial target: Exploring whether inhibition of HypV could sensitize pathogenic E. coli to oxidative killing by immune cells.

  • Synthetic biology applications: Engineering HypV-based biosensors for detecting HOCl or other chlorine compounds in environmental or biological samples.

How might advances in technology impact future HypV studies?

Emerging technologies will likely transform HypV research:

  • CRISPR-based approaches: Precise genome editing to create subtle mutations in native hypV for studying function without overexpression artifacts.

  • Single-cell techniques: Investigating cell-to-cell variability in HypV activity and its impact on population-level HOCl resistance.

  • Advanced imaging: Super-resolution microscopy to visualize HypV localization and potential clustering during activation.

  • Machine learning approaches: Identifying subtle patterns in large datasets to predict HypV interactions and regulatory networks.

  • Microfluidics: Creating controlled gradients of HOCl to study bacterial responses under more physiologically relevant conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.