Recombinant Escherichia coli Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction

UbiB, or Recombinant Escherichia coli Probable ubiquinone biosynthesis protein UbiB, is a protein involved in the biosynthesis of ubiquinone (CoQ) in Escherichia coli . Ubiquinone is an essential isoprenoid quinone that acts as an electron and proton shuttle in respiratory chains and other biological processes . It is primarily utilized under aerobic conditions, while demethylmenaquinones are used anaerobically . UbiB is considered an atypical kinase-like protein, but its precise role in ubiquinone biosynthesis remains unclear .

Genetic and Functional Characterization

The ubiB gene is located in an operon with ubiE and yigP . Specifically, ubiB is the 5' gene in an operon containing ubiE, yigP, and ubiB . UbiE encodes a C-methyltransferase necessary for synthesizing both CoQ and menaquinone . Research indicates that a mutation in ubiE has a polar effect on ubiB, which results in the accumulation of octaprenylphenol . Octaprenylphenol is a CoQ biosynthetic intermediate that accumulates in E. coli strains with the ubiB409 mutant allele .

Role in Ubiquinone Biosynthesis

UbiB is essential for the first monooxygenase step in CoQ biosynthesis . Mutants lacking ubiB are unable to synthesize ubiquinone and instead accumulate octaprenylphenol . In E. coli, two genes, ubiB and ubiD, are involved in successive reactions in ubiquinone biosynthesis and are closely linked .

UbiB as a Member of the Protein Kinase Family

The ubiB gene belongs to a family of predicted protein kinases . UbiB contains motifs found in eukaryotic-type protein kinases . It is speculated that UbiB may activate proteins required for the monooxygenase steps in ubiquinone biosynthesis via phosphorylation .

Regulation of Ubiquinone Biosynthesis

E. coli can synthesize CoQ in the absence of oxygen, suggesting the presence of an alternative hydroxylase that functions under anaerobic conditions . The regulation of CoQ synthesis in aerobic versus anaerobic cultures and the role of ubiB in this regulation remain open questions .

UbiTUV System

The ubiTUV genes control an anaerobic, oxygen-independent UQ biosynthesis pathway . These genes are transcribed as two divergent operons regulated by the oxygen-sensing Fnr transcriptional regulator . UbiUV-dependent UQ synthesis is essential for nitrate respiration and uracil biosynthesis under anaerobic conditions and contributes to bacterial multiplication in the mouse gut . UbiUV contributes to the hydroxylation of ubiquinone precursors via a unique oxygen-independent process . UbiT plays a crucial role in enabling E. coli to shift efficiently from anaerobic to aerobic conditions .

UbiT and UbiJ in Metabolon Formation

UbiT and UbiJ are required for forming two related but distinct metabolons: an anaerobic one containing UbiUV and an aerobic one containing UbiIHF . Both UbiJ and UbiT likely bind ubiquinone biosynthetic intermediates via their SCP2 domain, providing substrates to UbiUV and UbiIHF .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
ubiB; aarF; yigQ; yigR; yigS; b3835; JW3812; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ubiB
Target Protein Sequence
MTPGEVRRLYFIIRTFLSYGLDELIPKMRITLPLRLWRYSLFWMPNRHKDKLLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGLPVEA WFDDFEIKPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIKADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLYIPEVYPDYCSEGM MVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEH PENPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEEFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELPELVYDSLRQGKYLQH SVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFLLVSRPEWGLMPGWLMAGGLIAWFV GWRKTR
Uniprot No.

Target Background

Function

This protein is likely a protein kinase regulator of UbiI activity, involved in aerobic coenzyme Q (ubiquinone) biosynthesis.

Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UbiB protein and what is its confirmed function in E. coli?

UbiB is a protein involved in ubiquinone (coenzyme Q8) biosynthesis in Escherichia coli. Initial confusion existed about its identity, but research has confirmed that UbiB is distinct from the fre gene that was once mistakenly identified as ubiB. Disruption mutants of ubiB in E. coli accumulate octaprenylphenol, which is the intermediate expected to accumulate when the first monooxygenase step in ubiquinone biosynthesis is blocked. This confirms UbiB's role in the early hydroxylation reactions of the ubiquinone biosynthetic pathway .

Methodologically, to study UbiB function:

  • Generate ubiB knockout strains using gene disruption techniques

  • Analyze accumulated ubiquinone intermediates through HPLC and electrochemical detection

  • Perform complementation studies using plasmid-expressed ubiB to confirm gene function

  • Compare growth characteristics on different carbon sources, especially succinate-defined medium, which requires functional electron transport

How can researchers differentiate between ubiB and other genes involved in ubiquinone biosynthesis?

Researchers can differentiate ubiB from other ubiquinone biosynthesis genes through several methodological approaches:

  • Genetic complementation studies: Transform ubiB mutant strains with plasmids containing different ubi genes to determine which can restore ubiquinone production.

  • Intermediate profiling: Analyze accumulated intermediates in different ubi mutants. For example, ubiB mutants accumulate octaprenylphenol, whereas other gene knockouts may accumulate different intermediates .

  • Growth phenotype analysis: Compare growth characteristics of different ubi mutants on media requiring functional respiratory chains.

  • Protein domain analysis: UbiB contains specific domains that differentiate it from other ubiquinone biosynthesis proteins.

  • Cross-species complementation: Test if the ubiB homolog from other species (e.g., aarF from P. stuartii) can complement E. coli ubiB mutants .

It's worth noting that the original ubiB mutant strain (AN59) was found to have an IS1 element in the ubiE coding region, creating a polar mutation affecting downstream ubiB expression, which complicated early research efforts .

What experimental designs are most effective for studying UbiB function in recombinant E. coli systems?

When studying UbiB function in recombinant E. coli systems, several experimental designs have proven effective:

  • Randomized Complete Block Design: This approach is particularly valuable when working with different E. coli strains or plasmid constructs. By organizing experiments into blocks (e.g., different growth conditions), researchers can minimize variability unrelated to the UbiB manipulation . For example:

Block (Growth Condition)Wild-type E. coliubiB KnockoutubiB Complemented
AerobicCoQ8 levels (ng/mg)CoQ8 levelsCoQ8 levels
MicroaerobicCoQ8 levels (ng/mg)CoQ8 levelsCoQ8 levels
AnaerobicCoQ8 levels (ng/mg)CoQ8 levelsCoQ8 levels
  • Factorial Design: This is optimal when investigating multiple factors affecting UbiB function, such as oxygen availability, carbon source, and genetic background . A factorial design enables researchers to identify interaction effects between these variables.

  • Mixed Methods Approach: Combining quantitative measurements (CoQ8 levels, growth rates) with qualitative assessments (protein localization, protein-protein interactions) provides a more comprehensive understanding of UbiB function .

For recombinant expression studies:

  • Use inducible promoter systems with varying induction levels to avoid toxicity

  • Include proper controls (empty vector, inactive mutant versions of UbiB)

  • Validate protein expression through Western blotting or activity assays

  • Consider growth conditions that reflect varying oxygen levels to understand UbiB function in different environments

What analytical methods can be used to detect and quantify UbiB-dependent ubiquinone biosynthesis in E. coli?

Researchers can employ several analytical methods to detect and quantify UbiB-dependent ubiquinone biosynthesis:

  • HPLC with Electrochemical Detection:

    • Extract total lipids from cell pellets using organic solvents

    • Separate ubiquinone and intermediates on a C18 reverse-phase column

    • Quantify using electrochemical detection with calibrated standards

    • Typical wild-type E. coli contains approximately 40.3 ± 6.2 ng of CoQ8 per mg (dry weight) of cells

  • Mass Spectrometry Analysis:

    • LC-MS/MS allows for precise identification of ubiquinone and intermediates

    • Can detect subtle modifications in the isoprenoid side chain

    • Enables isotope labeling studies to track biosynthetic pathways

  • Genetic Reporter Systems:

    • Engineer strains where growth depends on functional ubiquinone biosynthesis

    • Use fluorescent or luminescent reporters linked to respiratory activity

  • Oxygen Consumption Measurements:

    • Measure respiratory capacity using oxygen electrodes

    • Compare oxygen consumption rates between wild-type, mutant, and complemented strains

  • Enzymatic Assays:

    • In vitro reconstitution of UbiB activity using purified components

    • Monitor hydroxylation reactions using spectrophotometric methods

These methods should be calibrated using proper controls, including known ubiquinone standards and well-characterized mutant strains with defined defects in the biosynthetic pathway.

How does UbiB function in the context of both O2-dependent and O2-independent ubiquinone biosynthesis pathways?

UbiB functions within a complex network of ubiquinone biosynthesis that can operate under both aerobic and anaerobic conditions. Recent research has revealed fascinating insights into this dual functionality:

In the O2-dependent pathway, UbiB appears to be involved in the initial monooxygenase step, requiring molecular oxygen as a co-substrate for hydroxylation reactions. Disruption of ubiB leads to accumulation of octaprenylphenol, confirming its role in early hydroxylation steps .

Key experimental findings on the relationship between UbiB and O2-independent pathways:

  • Protein interactions: Investigations into whether UbiB interacts with components of the O2-independent pathway (UbiU-UbiV complex) provide insight into potential cross-regulation.

  • Iron-sulfur cluster analysis: UbiU and UbiV form a heterodimer with each protein binding a 4Fe-4S cluster via conserved cysteines that are essential for activity . Researchers should investigate whether UbiB has any role in iron-sulfur cluster assembly or stability.

  • Differential expression analysis: Under varying oxygen conditions, the expression patterns of ubiB versus ubiT, ubiU, and ubiV can reveal regulatory mechanisms that control pathway switching.

  • Metabolic flux analysis: Using isotope-labeled precursors can help determine the relative contribution of UbiB-dependent versus UbiU/V-dependent pathways under different oxygen tensions.

Methodologically, researchers should employ anaerobic culturing techniques, controlled oxygen gradients, and genetic approaches targeting both pathways simultaneously to fully understand the interplay between these systems.

What structural and functional domains are critical for UbiB activity, and how can they be experimentally characterized?

Understanding the structure-function relationships in UbiB requires sophisticated experimental approaches:

  • Domain identification and characterization:

    • Bioinformatic analysis reveals UbiB contains domains similar to kinases and hydroxylases

    • Protein truncation and domain swapping experiments can identify functional regions

    • Point mutations at conserved residues can reveal catalytic sites

  • Crystal structure determination:

    • X-ray crystallography of purified UbiB protein

    • Cryo-EM structures of UbiB alone or in complex with other proteins

    • In silico molecular modeling based on homologous proteins

  • Functional assays for specific domains:

    • ATP binding and hydrolysis assays if kinase domains are present

    • Cofactor binding studies (potential metal ions, flavins, etc.)

    • Hydroxylase activity assays using model substrates

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Bacterial two-hybrid screening

    • Cross-linking mass spectrometry to map interaction surfaces

  • Comparative analysis with homologs:

    • Alignment with the AarF protein from P. stuartii provides insights into conserved functional regions

    • Comparison with other ubiquinone biosynthesis proteins (UbiU/V) to understand functional divergence

Domain/RegionPredicted FunctionExperimental ApproachKey Residues
N-terminal domainSubstrate bindingMutation analysis, substrate affinity assaysTo be determined
Central regionCatalytic activityEnzymatic assays, inhibitor studiesConserved motifs
C-terminal domainProtein-protein interactionsInteraction screens, crosslinkingTo be determined
Iron-sulfur bindingElectron transferEPR spectroscopy, iron quantificationConserved cysteines

This systematic approach will reveal critical insights into how UbiB structure determines its function in ubiquinone biosynthesis.

How can researchers resolve conflicting data regarding UbiB function in different E. coli strains?

Conflicting data regarding UbiB function across different E. coli strains is a common challenge. To address this systematically:

  • Strain background verification:

    • Sequence the entire ubi operon and surrounding regions in each strain

    • Check for unintended mutations, like the IS1 element found in strain AN59 that affected ubiB function

    • Verify genetic backgrounds through whole-genome sequencing

  • Standardized experimental conditions:

    • Implement factorial design experiments to test multiple variables simultaneously

    • Ensure identical growth conditions (media, temperature, aeration)

    • Use randomized block designs to control for batch effects

  • Complementation analysis:

    • Transform each strain with the same ubiB expression construct

    • Test cross-complementation with ubiB homologs (e.g., aarF from P. stuartii)

    • Analyze rescue efficiency through multiple metrics (growth rate, ubiquinone levels)

  • Polar effect elimination:

    • Design non-polar knockout mutations

    • Use complementation with individual genes to resolve operon effects

    • Implement CRISPR-Cas9 for precise genetic manipulations

  • Statistical approaches to resolve discrepancies:

    • Perform meta-analysis of data from multiple laboratories

    • Use Bayesian methods to account for strain-specific variation

    • Implement mixed-effects models to analyze data with strain as a random effect

When researchers identified that the original ubiB mutant (AN59) actually contained an IS1 element in the ubiE coding region, it resolved years of conflicting data by showing that the actual defect was a polar mutation affecting the downstream ubiB gene . This highlights the importance of comprehensive genetic verification.

What are the most common pitfalls in UbiB expression and purification, and how can they be overcome?

Working with UbiB presents several technical challenges that researchers should anticipate:

  • Protein solubility issues:

    • UbiB may form inclusion bodies when overexpressed

    • Solution: Use solubility-enhancing fusion tags (MBP, SUMO)

    • Lower induction temperature (16-20°C) and inducer concentration

    • Consider native purification conditions that preserve physiological interactions

  • Loss of cofactors during purification:

    • If UbiB binds cofactors (iron-sulfur clusters, similar to UbiU/V) , they may be lost during purification

    • Solution: Perform purification under anaerobic conditions

    • Include cofactor precursors in purification buffers

    • Reconstitute cofactors in vitro after purification

  • Stability problems:

    • Membrane-associated proteins often have stability issues

    • Solution: Optimize buffer conditions (pH, salt, glycerol)

    • Add stabilizing agents (specific lipids, detergents)

    • Implement thermal shift assays to identify stabilizing conditions

  • Activity loss during purification:

    • Enzymatic activity may decrease during purification steps

    • Solution: Minimize purification steps

    • Use activity assays at each purification stage

    • Consider purifying protein complexes rather than individual proteins

  • Expression level optimization:

    • Low yields or toxicity upon overexpression

    • Solution: Test various expression systems (pET, pBAD, pRSET)

    • Use tight promoter control and codon-optimized sequences

    • Consider cell-free expression systems for toxic proteins

Purification StageCommon IssueResolution StrategySuccess Indicator
Cell lysisProtein degradationProtease inhibitors, low temperatureIntact protein on SDS-PAGE
Initial capturePoor binding to resinOptimize tag position, buffer conditionsHigh capture efficiency
Intermediate stepsLoss of activityMinimize steps, maintain cofactorsActivity assays at each step
Final polishingAggregationAdd stabilizers, optimize salt/pHMonodisperse peak on SEC
StorageActivity loss over timeIdentify optimal storage conditionsRetained activity after freeze-thaw

Researchers have observed that when complementing ubiB mutants with plasmid-expressed UbiB, the rescue may not be as efficient as expected. This could be due to overexpression resulting in aggregated or inactive protein, or possibly because the promoter driving expression is suboptimal relative to the normal chromosomal promoter .

How might the discovery of O2-independent ubiquinone biosynthesis pathways influence future research on UbiB and related proteins?

The recent discovery of an O2-independent pathway for ubiquinone biosynthesis involving UbiT, UbiU, and UbiV opens exciting new research directions for UbiB studies:

  • Evolutionary relationships:

    • Comparative genomic analysis of organisms possessing both pathways

    • Phylogenetic studies to understand the evolution of oxygen-dependent versus oxygen-independent mechanisms

    • Investigation of horizontal gene transfer patterns in ubiquinone biosynthesis genes

  • Regulatory networks:

    • How does E. coli regulate the expression of O2-dependent (UbiB) versus O2-independent (UbiU/V) pathways?

    • Transcriptomic and proteomic studies under varying oxygen tensions

    • Identification of transcription factors and small RNAs controlling pathway switching

  • Structural biology approaches:

    • Comparative structural analysis of UbiB versus UbiU/V proteins

    • Investigation of potential shared cofactors or reaction mechanisms

    • Structure-guided design of pathway-specific inhibitors

  • Metabolic engineering opportunities:

    • Exploitation of O2-independent pathways for ubiquinone production in biotechnology

    • Engineering of hybrid pathways with enhanced properties

    • Development of strains capable of ubiquinone production under any condition

  • Microbiome and pathogen research:

    • How do gut bacteria use these pathways in the low-oxygen environment of the intestine?

    • Role of these pathways in pathogen survival during infection

    • Potential for pathway-specific antimicrobials

The existence of UbiT, UbiU, and UbiV in many alpha-, beta-, and gammaproteobacterial clades, including several human pathogens , suggests that the capacity to synthesize ubiquinone in the absence of O2 is widespread and may be important for bacterial adaptation to environments with fluctuating oxygen levels.

What cutting-edge techniques could advance our understanding of UbiB's role in ubiquinone biosynthesis?

Several emerging technologies hold promise for deepening our understanding of UbiB's role:

  • Cryo-electron microscopy (Cryo-EM):

    • Determine high-resolution structures of UbiB alone and in complex with partners

    • Visualize conformational changes during catalytic cycles

    • Examine UbiB integration within larger biosynthetic complexes

  • Proximity labeling proteomics:

    • BioID or APEX2 fusion proteins to identify UbiB's molecular neighborhood

    • Temporal mapping of protein interactions during ubiquinone biosynthesis

    • Comparative interactomes under aerobic versus anaerobic conditions

  • Single-molecule techniques:

    • FRET studies to monitor conformational changes in real-time

    • Single-molecule tracking in living cells to observe UbiB dynamics

    • Optical tweezers to measure forces during substrate processing

  • CRISPR-based approaches:

    • CRISPRi for tunable repression of ubiB and related genes

    • CRISPR activation to enhance expression in specific conditions

    • Base editors for precise point mutations without selection markers

  • Synthetic biology strategies:

    • Minimal synthetic pathways to define essential components

    • Orthogonal ubiquinone pathways with non-native components

    • Cell-free systems to reconstitute ubiquinone biosynthesis in vitro

  • Advanced computational methods:

    • Molecular dynamics simulations of UbiB with substrates

    • Machine learning models to predict functional residues

    • Systems biology approaches to model pathway flux

  • Metabolic flux analysis:

    • 13C-labeled metabolite tracing through the pathway

    • Real-time metabolomics to track intermediate formation

    • Integration with transcriptomics data for comprehensive pathway mapping

These cutting-edge approaches will provide unprecedented insights into UbiB's function and will help resolve the remaining questions about ubiquinone biosynthesis across the full oxygen spectrum .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.