Recombinant Escherichia coli Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli Prolipoprotein Diacylglyceryl Transferase (Lgt)

Recombinant Escherichia coli prolipoprotein diacylglyceryl transferase (Lgt) is a membrane-embedded enzyme critical for bacterial lipoprotein biogenesis. It catalyzes the first step in post-translational lipid modification by transferring a diacylglyceryl group from phosphatidylglycerol (PG) to the conserved cysteine residue in the "lipobox" motif of prolipoproteins. This modification is essential for anchoring lipoproteins to the bacterial membrane, influencing cell envelope integrity, virulence, and antibiotic resistance .

Lgt operates via a thioether bond formation mechanism:

  1. PG binds to the enzyme's central cavity.

  2. The conserved cysteine in the lipobox motif attacks the C3 atom of PG’s diacylglyceryl moiety.

  3. Glycerol phosphate (G1P/G3P) is released as a by-product .

3.1. Essentiality and Genetic Studies

  • Gene deletion studies: lgt knockout is lethal in E. coli and other Gram-negative bacteria, underscoring its indispensability .

  • Complementation assays: Heterologous lgt genes (e.g., from Vibrio cholerae) restore viability in E. coli Δlgt strains .

3.2. Biochemical Assays

  • In vitro activity: A GFP-based assay using lipoGFP (engineered with Lpp24 peptide) confirmed Lgt’s diacylglyceryl transferase activity .

  • Inhibitor screening: Macrocyclic compounds (e.g., G2823, G2824) inhibit Lgt with IC<sub>50</sub> values ≤1 μM, showing bactericidal effects against E. coli and Acinetobacter baumannii .

CompoundIC<sub>50</sub> (μM)Target Specificity
G28230.93Lgt
G28240.18Lgt
Palmitic acidN/ACompetitive inhibitor

3.3. Physiological Impact of Lgt Depletion

  • Membrane destabilization: Lgt depletion increases outer membrane permeability, enhancing sensitivity to serum killing and antibiotics (e.g., vancomycin) .

  • Virulence attenuation: E. coli CFT073 Δlgt shows reduced pathogenicity in murine infection models .

4.1. Antibiotic-Free Plasmid Selection

  • Plasmid stabilization: lgt-based systems enable plasmid maintenance without antibiotics by complementing chromosomal lgt deletions .

  • Example: V. cholerae Δlgt complemented with E. coli lgt produces cholera toxin B subunit (CTB) for vaccine development .

4.2. Novel Antibacterial Targets

  • Inhibitor development: Lgt inhibitors bypass resistance mechanisms linked to outer membrane lipoprotein (Lpp) deletion, unlike inhibitors of downstream lipoprotein biogenesis steps .

Future Directions

  • Structural optimization: High-resolution Lgt-inhibitor complexes could guide drug design .

  • Broad-spectrum potential: Targeting Lgt in multidrug-resistant Gram-negative pathogens (e.g., A. baumannii) warrants further exploration .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; ECSE_3085; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Escherichia coli (strain SE11)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, initiating the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Lgt in bacterial physiology?

Lgt (prolipoprotein diacylglyceryl transferase) is an integral membrane enzyme that catalyzes the first reaction in bacterial lipoprotein biosynthesis. It transfers the diacylglyceryl group from phosphatidylglycerol (PG) to the thiol group of the conserved cysteine residue in the lipobox sequence of prolipoproteins . This lipid modification is crucial for anchoring various proteins to bacterial membranes, allowing them to perform essential functions in cellular physiology. The importance of Lgt is underscored by the fact that knockout of the lgt gene is lethal to most Gram-negative bacteria, highlighting its essential role in bacterial viability .

The lipid modification process begins with Lgt recognizing the lipobox motif ([LVI][ASTVI][GAS]C) present in prolipoproteins, then catalyzing the transfer of the diacylglyceryl moiety to create lipid-modified proteins that can properly localize to the bacterial membrane . This post-translational modification is fundamental to bacterial physiology and affects numerous cellular processes, including nutrient acquisition, cell envelope integrity, and virulence in pathogenic bacteria.

How is the lgt gene structurally organized in E. coli?

In E. coli, the lgt gene (previously known as umpA) encodes Lgt as a 291-amino acid (33 kDa) membrane protein . The gene structure can be analyzed through molecular techniques such as PCR amplification of the flanking regions. Researchers working with related organisms like Listeria monocytogenes have designed primers targeting conserved regions to amplify lgt gene fragments, which can be adapted for E. coli studies .

When studying Lgt gene organization, it's important to consider:

  • The promoter region controlling lgt expression

  • Adjacent genes that may be co-regulated

  • Conserved motifs within the coding sequence that correlate with enzyme function

  • Presence of regulatory elements affecting transcription and translation

For precise genetic manipulation, researchers can design primers that target the 5' and 3' flanking regions of the lgt gene. These can be used for gene deletion, complementation studies, or site-directed mutagenesis to investigate structure-function relationships.

What expression systems are most effective for producing recombinant E. coli Lgt?

Based on the research data, several expression systems have been successfully used to produce recombinant E. coli Lgt for structural and functional studies. When selecting an expression system, researchers should consider the following methodological approaches:

  • Homologous expression: Expressing E. coli Lgt in E. coli host strains provides the advantage of native cellular machinery for proper folding and membrane insertion. Research indicates that wild-type E. coli can produce various Lgt homologs, including those from S. enterica and H. influenzae, with varying efficiency .

  • Inducible expression systems: IPTG-inducible promoters have been successfully used for controlled expression of Lgt variants. This approach allows for titration of expression levels, which is crucial when studying membrane proteins that may be toxic when overexpressed .

  • Codon optimization: For heterologous expression of Lgt proteins from other bacterial species in E. coli, codon optimization may improve expression. Studies show that codon optimization of lgt from S. agalactiae slightly increased protein production, though this approach was not effective for S. aureus Lgt .

  • Expression verification: Western blotting with specific antibodies against Lgt is an effective method to confirm successful expression. For optimal detection, researchers should prepare protein extracts from cultures grown to appropriate density (typically stationary phase, OD600 of 1.8) .

When expressing Lgt homologs from diverse bacterial species, researchers should be aware that not all homologs express equally well in E. coli. For instance, while Lgt from Enterococcus faecalis was efficiently produced in E. coli, Lgt from Staphylococcus aureus and Streptococcus agalactiae showed poor expression even after codon optimization .

What are the essential components of an Lgt activity assay?

Developing reliable assays for Lgt activity is crucial for understanding its function and identifying potential inhibitors. Based on the research data, an effective Lgt activity assay should include:

  • Substrate preparation: The assay requires both the lipid donor (phosphatidylglycerol) and the acceptor substrate (prolipoprotein or a synthetic peptide containing the lipobox motif) .

  • Detection method: A GFP-based in vitro assay has been used successfully to correlate Lgt activities with structural observations. This approach allows for quantitative measurement of diacylglyceryl transfer .

  • Controls: Include appropriate controls such as:

    • Negative control without Lgt enzyme

    • Positive control with wild-type Lgt

    • Controls with known inhibitors (e.g., palmitic acid)

  • Reaction conditions: Optimize buffer composition, pH, temperature, and reaction time. The assay should mimic the membrane environment where Lgt naturally functions.

  • Analysis of lipid modification: Methods to detect the lipid-modified product, which may include:

    • Mass spectrometry to detect the mass shift after lipid modification

    • Radioisotope-labeled lipid donors to track transfer activity

    • Immunological detection methods using antibodies specific to lipid-modified proteins

When implementing this assay, researchers should be aware that Lgt activity can vary significantly between homologs from different bacterial species, which may necessitate optimization of assay conditions for each specific enzyme variant being studied .

How do structural features of Lgt determine its substrate specificity and catalytic mechanism?

Recent crystal structures of E. coli Lgt in complex with phosphatidylglycerol and the inhibitor palmitic acid at 1.9 Å and 1.6 Å resolution, respectively, have provided significant insights into the enzyme's structural features and catalytic mechanism . These structural data reveal:

  • Binding sites: The structures show the presence of two distinct binding sites that accommodate the enzyme's substrates . One site binds the phospholipid donor (phosphatidylglycerol), while the other likely accommodates the prolipoprotein acceptor.

  • Lateral access mechanism: The structures support a mechanism whereby substrate and product (lipid-modified lipobox-containing peptide) enter and leave the enzyme laterally relative to the lipid bilayer . This lateral access is crucial for the enzyme to function within the membrane environment.

  • Critical catalytic residues: Structural and functional studies have identified several residues essential for catalysis, including Arg143 and Arg239 . These residues likely participate in coordinating the phospholipid substrate and facilitating the nucleophilic attack by the cysteine thiol of the lipobox.

  • Periplasmic head domain: The periplasmic or "head" domain plays a significant role in Lgt function . Experiments with chimeric enzymes where the head domain of E. coli Lgt was replaced with that from other bacteria (e.g., M. tuberculosis or S. aureus) resulted in impaired function, indicating this domain's importance in substrate recognition and/or catalysis .

  • Conserved residues: Analysis of 22 Lgt proteins from pathogenic species identified 16 completely conserved residues, suggesting their crucial role in the enzyme's function . These conserved residues likely form the catalytic core of the enzyme.

To experimentally investigate structure-function relationships, researchers can employ site-directed mutagenesis of critical residues followed by complementation assays in lgt-knockout strains. This approach has successfully demonstrated that mutations in residues like Arg143 and Arg239 abolish enzyme activity, confirming their essential role in catalysis .

What experimental approaches can resolve contradictory findings on Lgt essentiality across different bacterial species?

The essentiality of Lgt varies across bacterial species, with knockout being lethal in most Gram-negative bacteria but viable in some Gram-positive species . To resolve contradictory findings regarding Lgt essentiality, researchers can employ the following methodological approaches:

  • Conditional knockout systems: Rather than attempting complete gene deletion, which may be lethal, researchers can use:

    • Temperature-sensitive mutants of lgt

    • Depletion strains with arabinose-controlled lgt expression

    • IPTG-inducible systems for controlled expression of Lgt variants

  • Combinatorial gene deletions: Research shows that deletion of lgt in combination with deletion of other genes (e.g., lpp in E. coli) can alter the essentiality phenotype . The finding that "Lgt is essential for growth and viability of E. coli in the absence of Lpp" highlights the importance of considering genetic context when assessing essentiality .

  • Cross-species complementation: Testing whether Lgt from one species can complement lgt deletion in another species provides insights into functional conservation and species-specific requirements. For example, while Lgt homologs from proteobacteria generally complemented E. coli lgt deletion (in the absence of Lpp), Lgt from Firmicutes like S. aureus, S. agalactiae, and E. faecalis failed to restore function in E. coli .

  • Phenotypic characterization: Detailed analysis of the phenotypic consequences of lgt deletion provides insights into its functional importance. In Listeria monocytogenes, deletion of lgt impairs intracellular growth in eukaryotic cells and leads to increased release of lipoproteins into the culture supernatant .

  • Proteome analyses: Comparative extracellular proteome analyses of wild-type and Δlgt mutant strains can systematically identify the lipoproteins affected by lgt deletion. In L. monocytogenes, 26 of 68 predicted lipoproteins were specifically released into the extracellular proteome of the Δlgt strain .

Using these approaches, researchers can better understand the species-specific roles of Lgt and the cellular contexts that determine its essentiality.

How can Taguchi experimental design optimize Lgt expression and purification?

Taguchi experimental design offers a systematic approach to optimize the expression and purification of recombinant Lgt while minimizing the number of experiments required. This statistical method can be particularly valuable when dealing with membrane proteins like Lgt, which often present challenges in expression and purification . Here's how to apply this method:

  • Defining factors and levels for Lgt expression optimization:

    FactorLevel 1Level 2
    Expression temperature25°C37°C
    IPTG concentration0.1 mM1.0 mM
    Expression time4 hoursOvernight
    Growth mediumLB2YT
    Host strainBL21(DE3)C41(DE3)
    Detergent typeDDMLDAO
  • Factor selection process:

    • Organize brainstorming sessions with a multidisciplinary team to generate an exhaustive list of potential factors affecting Lgt expression and purification .

    • Assess the importance of each factor in terms of its potential impact on protein yield and activity .

    • Select factors based on their importance, ability to control them, and ease of reliable measurement .

  • Level selection criteria:

    • Beach width: Select levels that cover a sufficiently wide range to detect effects without going to unrealistic extremes .

    • Practicality: Ensure the levels selected are achievable in a real-life production context .

  • Experimental design implementation:

    • Use an orthogonal array to design experiments that test all selected factors with minimal experimental runs.

    • For the six factors listed in the table, an L8 orthogonal array would be appropriate, requiring only 8 experimental runs instead of 64 for a full factorial design.

  • Response variables to measure:

    • Protein yield (mg/L culture)

    • Purity (as determined by SDS-PAGE)

    • Enzymatic activity (using the GFP-based in vitro assay mentioned in section 1.4)

    • Structural integrity (assessed by circular dichroism or thermal stability assays)

  • Data analysis and interpretation:

    • Calculate the signal-to-noise ratio for each factor level to determine optimal conditions.

    • Perform analysis of variance (ANOVA) to determine the statistical significance of each factor.

    • Conduct confirmation experiments under the identified optimal conditions.

By applying Taguchi's experimental design, researchers can efficiently identify the optimal conditions for Lgt expression and purification, saving time and resources while improving reproducibility.

What methods are most effective for investigating domain-swapping experiments in Lgt homologs?

Domain-swapping experiments provide valuable insights into the functional contributions of different Lgt domains. Based on the research data, the following methodological approaches are most effective:

  • Domain identification and boundary definition:

    • Use structural information from crystal structures of E. coli Lgt to precisely define domain boundaries .

    • The periplasmic "head" domain and transmembrane "arm" domains should be clearly delineated based on structural data.

    • Bioinformatic analysis of sequence conservation across species can help identify conserved domain-specific motifs.

  • Chimeric construct design:

    • Create chimeric constructs where the head domain from E. coli Lgt is replaced with the corresponding domain from other species (e.g., M. tuberculosis or S. aureus) .

    • Ensure that domain junctions are designed to maintain proper protein folding and membrane topology.

    • Include appropriate epitope tags for detection and purification while minimizing interference with function.

  • Expression and functional assessment:

    • Express chimeric constructs in appropriate host systems, preferably in an lgt-knockout background to avoid interference from the native enzyme .

    • For E. coli-based systems, consider using both lgt-knockout strains (Δlgt) and double knockout strains lacking both lgt and lpp (ΔlgtΔlpp) to differentiate between complete loss of function and partial activity .

    • Assess function through:

      • Complementation assays measuring growth and morphology

      • Biochemical assays measuring enzymatic activity

      • Microscopy to evaluate cell morphology and potential lysis

  • Results interpretation:

    • If the chimeric enzyme Lgt-HeadMt (E. coli Lgt with M. tuberculosis head domain) fails to restore colony formation in Δlgt strains but allows growth to mid-exponential phase in ΔlgtΔlpp strains, this indicates partial functionality that is insufficient when substrate load is high (e.g., in the presence of abundant Lpp) .

    • Similarly, if Lgt-HeadSa (E. coli Lgt with S. aureus head domain) allows small colony formation on IPTG plates in ΔlgtΔlpp but not in Δlgt, this suggests species-specific adaptations in the head domain that affect substrate recognition or catalytic efficiency .

  • Structure-function correlation:

    • Correlate functional observations with structural differences between the domains.

    • Identify specific residues within the swapped domains that may account for functional differences.

    • Use site-directed mutagenesis to confirm the role of these residues.

These domain-swapping experiments have revealed that the periplasmic head domain plays a crucial role in Lgt function, with chimeric enzymes showing impaired function when the head domain is replaced with that from phylogenetically distant species .

How can researchers systematically identify and characterize the complete lipoprotein repertoire of a bacterial species using Lgt?

Deletion of the lgt gene provides a powerful approach for systematic identification and characterization of bacterial lipoproteins. The following methodological framework can be employed:

  • Generation of Δlgt mutant strains:

    • For non-essential lgt (as in some Gram-positive bacteria), create clean deletion mutants using targeted mutagenesis.

    • For essential lgt (as in most Gram-negative bacteria), generate conditional mutants or use the ΔlgtΔlpp approach to create viable strains .

    • Verify lgt deletion by PCR, Western blotting, and phenotypic analysis.

  • Comparative extracellular proteome analysis:

    • Collect culture supernatants from wild-type and Δlgt strains grown under identical conditions.

    • Process samples for proteomics analysis using appropriate protein concentration methods.

    • Perform high-resolution mass spectrometry to identify proteins.

    • Compare protein profiles to identify those specifically released in the Δlgt strain.

  • Bioinformatic prediction and validation:

    • Use bioinformatic tools to predict lipoproteins based on the presence of lipobox motifs in the genome.

    • Compare proteomics results with bioinformatic predictions to validate and refine prediction algorithms.

    • In L. monocytogenes, this approach identified 26 of 68 predicted lipoproteins in the extracellular proteome of the Δlgt strain, providing experimental verification of listerial lipoproteins .

  • Functional categorization of identified lipoproteins:

    • Classify identified lipoproteins based on predicted functions and cellular roles.

    • Identify lipoproteins likely involved in bacterial physiology and pathogenesis.

    • For pathogens, create additional mutant strains (e.g., ΔlgtΔprfA in L. monocytogenes) to detect lipoproteins regulated by virulence factors .

  • Validation and characterization of individual lipoproteins:

    • Generate specific antibodies against identified lipoproteins for Western blot analysis.

    • Create deletion mutants of specific lipoproteins to assess their individual contributions to phenotypes observed in the Δlgt strain.

    • Perform complementation studies to confirm phenotype-genotype relationships.

  • Quantitative analysis:

    • Use quantitative proteomics approaches (e.g., SILAC, iTRAQ) to assess relative abundance of different lipoproteins.

    • Compare lipoprotein profiles under different growth conditions to identify conditionally expressed lipoproteins.

    Analytical ApproachApplicationAdvantages
    2D-PAGESeparation of extracellular proteinsVisual comparison of protein spots
    LC-MS/MSIdentification of proteinsHigh sensitivity and throughput
    Western blottingValidation of specific lipoproteinsTargeted verification
    qPCRGene expression analysisTranscriptional regulation insights

This systematic approach using Δlgt strains has proven effective in providing comprehensive insights into the lipoprotein repertoire of bacterial species, contributing to our understanding of lipoprotein function in bacterial physiology and pathogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.