Recombinant Escherichia coli Protein AaeX (aaeX)

Shipped with Ice Packs
In Stock

Description

Functional Role in E. coli

AaeX is part of the AaeAB efflux pump system, which mediates the extrusion of aromatic carboxylic acids (e.g., p-hydroxybenzoic acid, pHBA) . This system functions as a "metabolic relief valve," alleviating cellular toxicity caused by metabolic imbalances .

Mechanism of Action

The AaeAB system comprises:

  • AaeR: A LysR-type transcriptional regulator.

  • AaeX: A small protein of unknown direct function (formerly annotated as yhcR).

  • AaeA: A membrane fusion protein (MFP).

  • AaeB: The outer membrane component (OMP) of the efflux pump.

While AaeX’s precise role remains undefined, its genetic linkage to aaeA and aaeB suggests involvement in efflux pump regulation or structural assembly .

Recombinant Production and Expression

AaeX is produced via recombinant expression in E. coli, leveraging optimized protocols for high-yield protein synthesis. Key considerations include:

Expression Challenges

  • Cytotoxicity: Overexpression of membrane proteins like AaeB can strain cellular resources, though AaeX itself is cytoplasmic or periplasmic .

  • Solubility: No reports of inclusion body (IB) formation for AaeX, but general strategies for E. coli recombinant proteins (e.g., chaperone co-expression, temperature optimization) may apply .

Optimized Expression Conditions

ParameterRecommendation
InductionL-arabinose (common inducer for T7-based systems)
Temperature16–30°C (moderate temperatures to balance solubility and yield)
StrainBL21(DE3) or derivatives (e.g., SHuffle® for disulfide bond-containing proteins)
PurificationNickel affinity chromatography (His-tag)

Research Applications and Future Directions

AaeX’s role in efflux systems positions it as a model for studying:

  • Antibiotic Resistance: Efflux pumps contribute to multidrug resistance; AaeX may inform strategies to inhibit pump activity .

  • Biotechnological Engineering: Engineering AaeX or its operon for enhanced substrate specificity in industrial bioprocesses .

Gaps and Opportunities

  • Structural Elucidation: Crystallographic studies of AaeX are absent, limiting mechanistic insights.

  • Functional Screens: High-throughput assays (e.g., APEX platform ) could map AaeX interactions within the AaeAB system.

Key Research Findings

  1. Efflux Pump Regulation: AaeX is co-expressed with aaeA and aaeB in response to aromatic carboxylic acids, indicating a regulatory or auxiliary role .

  2. Expression Efficiency: Recombinant AaeX achieves >90% purity, suggesting robust production in E. coli .

  3. Broader Implications: Insights from AaeX could extend to other efflux systems, aiding in antibiotic development or biopolymer production .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
aaeX; yhcR; b3242; JW5541; Protein AaeX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-67
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
aaeX
Target Protein Sequence
MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV
Uniprot No.

Target Background

Database Links
Protein Families
AaeX family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.