Recombinant Escherichia coli Protein AmpE (ampE)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Escherichia coli Protein AmpE (AmpE) is a full-length bacterial protein produced via genetic engineering for research and industrial applications. Derived from the ampE gene (UniProt ID: P0AE14), this 284-amino-acid protein plays roles in bacterial cell wall metabolism and beta-lactam antibiotic resistance modulation . Its recombinant form is fused with an N-terminal histidine (His) tag for simplified purification and detection . Below, we synthesize structural, functional, and production data from diverse sources to provide a comprehensive overview.

Physicochemical Properties

PropertySpecification
Molecular Weight~32 kDa (calculated)
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer, 6% Trehalose
StabilityLyophilized powder; avoid freeze-thaw

Role in Beta-Lactam Resistance

AmpE contributes to intrinsic beta-lactam resistance in E. coli by interacting with peptidoglycan (PG) remodeling pathways. Key findings include:

  • Synergy with AmpD: Deletion of ampE and ampD increases bacterial susceptibility to beta-lactams (e.g., cephalosporins) .

  • Mechanism: AmpE likely acts as an indirect beta-lactam sensor, stabilizing PG integrity during antibiotic exposure .

  • Complementary Activity: Ectopic expression of AmpD amidase in ampE-deficient strains partially restores resistance .

Cell Wall Metabolism

AmpE is implicated in maintaining cell wall homeostasis, with homology to transporters involved in muropeptide recycling . Its absence disrupts PG fragment processing, increasing vulnerability to antibiotics targeting penicillin-binding proteins (PBPs) .

Expression System

  • Host: E. coli

  • Vector: pET-series plasmids with T7 promoters

  • Induction: Typically uses IPTG (isopropyl β-D-1-thiogalactopyranoside)

Purification Protocol

  1. Affinity Chromatography: Nickel-nitrilotriacetic acid (Ni-NTA) resin captures His-tagged AmpE .

  2. Elution: Imidazole gradient (0–500 mM) .

  3. Buffer Exchange: Dialysis against Tris/PBS buffers to remove imidazole .

Yield and Stability

  • Yield: >90% purity post-purification

  • Storage: -20°C/-80°C in lyophilized form; reconstitute in sterile water (0.1–1.0 mg/mL) with 50% glycerol for long-term stability .

Antibiotic Resistance Studies

AmpE serves as a model protein to investigate:

  • Beta-lactam resistance mechanisms in Gram-negative bacteria .

  • Synergistic interactions with AmpD amidase .

Biotechnological Optimization

  • Metabolic Burden: High-copy plasmids (e.g., pMB1 origin) reduce yields compared to low-copy systems (e.g., p15A origin) .

  • Signal Peptides: Co-translational targeting sequences (e.g., Hbp) enhance periplasmic production efficiency .

Challenges and Future Directions

  • Solubility Issues: Overexpression in E. coli risks inclusion body formation, requiring fusion partners or chaperones .

  • Functional Characterization: The exact biochemical role of AmpE remains under investigation, necessitating structural studies .

  • Therapeutic Potential: Engineered AMPs (antimicrobial peptides) inspired by AmpE-like systems show promise against drug-resistant pathogens .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your desired tag type for prioritized development.
Synonyms
ampE; b0111; JW0107; Protein AmpE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ampE
Target Protein Sequence
MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLGMTIIAMGVTFLLLRA LQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSHARATMAGELTMIHGVP AGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLMGYAFLRAWQYWLARYQT PHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWFASLGDFHTSQYQVLTRLA QFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYGALV
Uniprot No.

Target Background

Function
AmpE is a putative signaling protein involved in beta-lactamase regulation. However, it does not appear to function as a direct beta-lactam sensor.
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What expression systems are most suitable for recombinant AmpE production in E. coli?

The pET expression system stands out as particularly effective for recombinant AmpE production due to its powerful T7 promoter system under IPTG induction. The pET-28a vector combined with BL21(DE3) E. coli strains offers tight regulation of expression through the lac operator and high-level production upon induction . This system allows for the addition of fusion tags such as 6×His-tag, facilitating downstream purification using metal-chelate affinity chromatography . When choosing between periplasmic and cytoplasmic expression, consider whether post-translational modifications or proper disulfide bond formation is required for AmpE functionality.

Expression yields can be significantly enhanced by optimizing parameters such as cell growth conditions, IPTG concentration, antibiotic levels before and during induction, and cell density at induction . The optimized protocol has shown protein production significantly enhanced compared to traditional IPTG induction methods, even without a fermentor .

  • What genetic engineering approaches can optimize AmpE gene insertion in E. coli?

Recombineering (recombination-mediated genetic engineering) offers precise methods for integrating and optimizing the AmpE gene in E. coli:

The bacterial chromosome and plasmids can be engineered in vivo using homologous recombination with PCR products, synthetic dsDNA, or ssDNA as substrates . This approach allows DNA sequences to be inserted without restriction site limitations and can be combined with CRISPR/Cas targeting systems for improved efficiency .

Several strategic options exist for optimizing AmpE gene insertion:

ApproachMethodologyAdvantage
Basic recombineeringTransformation with linear DNA containing homology armsPrecise modification without restriction enzymes
CRISPR/Cas9 counter-selectionCombining recombineering with CRISPR/Cas9 targetingReduces non-recombinant background, allows non-selectable alterations
In vivo plasmid assemblyAssembly of linear dsDNA fragments into functional plasmidsStreamlined cloning process
Allele retrievalGap repair to capture genomic sequences onto plasmidsEasy transfer of chromosomal variants

The λ Red system (Exo, Beta, Gam) or the Rac prophage RecET system provides the recombination functions necessary for these approaches . For researchers new to these techniques, following established protocols for making electrocompetent cells and transforming with linear DNA is recommended as a starting point.

  • How can researchers optimize cell growth conditions for maximum AmpE expression?

Optimizing cell growth conditions is critical for maximizing AmpE expression in E. coli. Based on established protocols, several parameters require systematic optimization:

Temperature management significantly impacts protein folding and solubility. While standard growth at 37°C maximizes growth rate, reducing temperature to 16-25°C after induction can dramatically improve protein solubility by slowing the synthesis rate and allowing more time for proper folding .

Media composition affects both cell density and protein yield. LB medium serves as a standard option, but richer media like TB (Terrific Broth) can support higher cell densities . The addition of glucose (0.5-1%) can reduce basal expression in some systems, preventing premature protein production that might be toxic.

Cell density at induction represents a critical parameter. Research suggests that high cell density combined with high copy number of recombinant plasmid significantly enhances recombinant protein production . For T7-based systems, induction typically begins at OD600 of 0.6-0.8, but higher densities (OD600 of 1.0-2.0) may yield better results for some proteins.

IPTG concentration requires careful optimization, typically testing a range from 0.1 mM to 1.0 mM. Lower concentrations may favor soluble protein production over inclusion bodies .

Post-induction harvest time should be determined empirically. Expression studies show increasing yields from 1 to 4 hours post-induction for many recombinant proteins . SDS-PAGE analysis at different time points (2, 4, 6, and overnight hours) can identify the optimal harvest time.

  • What purification strategies yield the highest purity recombinant AmpE?

A multi-step purification strategy typically yields the highest purity recombinant AmpE while preserving biological activity:

Metal-chelate affinity chromatography serves as an excellent first step when AmpE is expressed with a His-tag fusion. Nickel-nitrilotriacetic acid (Ni-NTA) resin purification under native conditions is highly effective, using a gradient of imidazole concentration (0–100%) for elution . This approach can achieve 80-90% purity in a single step.

Ion exchange chromatography (e.g., DEAE-Sepharose fast-flow) can serve as either a primary purification method or a secondary polishing step, separating proteins based on charge differences . This is particularly useful when His-tag purification leaves contaminants.

Fusion tag removal may be necessary for functional studies. If a methionine residue is positioned between the tag and AmpE, cyanogen bromide (CNBr) cleavage provides an efficient chemical method for tag removal . Alternatively, specific proteases (thrombin, TEV, etc.) can be used when recognition sites are incorporated into the construct.

Reverse-phase HPLC as a final purification step can achieve very high purity levels, as demonstrated in the purification of other recombinant proteins . This step is particularly important for removing any remaining host cell proteins or contaminants.

Purification under native conditions is preferable when functional activity must be preserved. Throughout the purification process, protein concentration can be monitored using Bradford assay with bovine serum albumin as a standard .

Advanced Research Questions

  • How does codon optimization affect the expression efficiency of AmpE in E. coli?

Codon optimization significantly enhances AmpE expression efficiency in E. coli through several key mechanisms that directly affect translation:

The genetic code's redundancy means multiple codons can encode the same amino acid, but E. coli preferentially uses certain codons over others. Optimizing the AmpE gene sequence to use E. coli's preferred codons increases translation efficiency, particularly for rare codons that might otherwise cause translational pausing or premature termination .

mRNA secondary structure near the translation initiation region critically affects expression levels. Optimizing the mRNA structure based on low ΔG (dG) and energy of the start codon can help ribosome binding and translation initiation . The 5' terminus should be folded in a way typical of bacterial gene structures, with sufficient stability for effective translation.

The minimum free energy for secondary structures formed by mRNA molecules directly impacts translation efficiency. In successful recombinant expression systems, the ΔG of optimized structures typically ranges from -60 to -70 kcal/mol, indicating sufficient stability for effective translation .

A comparative expression study would likely show significant improvements in AmpE expression after codon optimization:

ParameterNon-optimized AmpECodon-optimized AmpE
Expression yield (mg/L)Baseline2-10 fold increase
Translation efficiencyLowerEnhanced
mRNA stabilityVariableImproved
Protein solubilityVariablePotentially improved
  • What are the most effective strategies for improving solubility of recombinant AmpE?

Improving recombinant AmpE solubility requires a multi-faceted approach that addresses protein folding dynamics in E. coli:

Fusion tags significantly enhance solubility for many proteins. Solubility-enhancing fusion partners such as MBP (maltose-binding protein), SUMO, or Thioredoxin can dramatically improve AmpE solubility . Research has demonstrated that fusion protein approaches successfully prevent aggregation and increase expression levels in E. coli .

Expression condition optimization plays a crucial role in solubility. Key parameters include:

  • Lower induction temperature (16-25°C instead of 37°C) to slow down protein synthesis

  • Reduced IPTG concentration (0.1-0.5 mM instead of 1 mM)

  • Expression at higher cell densities as noted in established protocols

  • Addition of specific chemical chaperones such as osmolytes

Compartmentalization can significantly impact folding. Directing AmpE to the periplasmic space using appropriate signal sequences can promote proper folding and disulfide bond formation if needed, similar to approaches used for other proteins . Periplasmic expression often results in more correctly folded protein due to the oxidizing environment and presence of specific chaperones.

Co-expression with molecular chaperones like GroEL/GroES or DnaK/DnaJ/GrpE can assist in proper protein folding and prevent aggregation. Specialized plasmid systems are available that allow controlled co-expression of multiple chaperone systems.

The effectiveness of these strategies varies based on protein characteristics:

StrategyPotential Impact on AmpE SolubilityImplementation Complexity
Fusion tagsHighModerate
Lower temperatureModerateLow
Reduced IPTGLow-ModerateLow
Higher cell densityLow-ModerateModerate
Chaperone co-expressionModerate-HighHigh
Periplasmic expressionHighHigh
  • How can researchers differentiate between structural and functional variations in recombinant versus native AmpE?

Differentiating between structural and functional variations in recombinant versus native AmpE requires a systematic analytical approach:

Structural comparison techniques provide insight into protein folding differences:

  • Circular Dichroism (CD) Spectroscopy reveals secondary structure elements (α-helices, β-sheets)

  • Fluorescence Spectroscopy examines tertiary structure through intrinsic fluorescence of aromatic amino acids

  • Thermal Stability Analysis using differential scanning calorimetry (DSC) or thermal shift assays can reveal differences in protein stability

  • Limited Proteolysis patterns expose structural differences through differential susceptibility to controlled proteolytic digestion

Functional comparison requires activity-based assessments:

  • Enzymatic Activity Assays comparing specific activity metrics between native and recombinant forms

  • Binding Assays measuring interaction kinetics with known binding partners

  • In vivo Complementation testing whether recombinant AmpE can restore function in an ampE deletion strain

  • Physiological Response Measurements assessing whether cellular responses match those of native protein

An integrated analytical framework allows comprehensive comparison:

Analysis TypeParameter MeasuredCorrelation with Function
CD SpectroscopySecondary structure contentHigh correlation with proper folding
Thermal StabilityMelting temperature (Tm)More stable proteins often retain better function
Enzymatic ActivitySpecific activity (units/mg)Direct measure of functionality
Binding KineticsKd, kon, koffDirectly relates to biological interactions
In vivo AssaysPhysiological responseUltimate test of biological equivalence

When discrepancies are identified, optimization of expression and purification conditions may yield more native-like recombinant protein. If functional differences persist despite structural similarity, absent post-translational modifications may be critical to function .

  • What approaches can minimize proteolytic degradation of recombinant AmpE during expression?

Minimizing proteolytic degradation of recombinant AmpE requires a combination of genetic, environmental, and methodological strategies:

Strain selection forms the foundation of proteolysis prevention. Protease-deficient strains like BL21(DE3), which lacks the lon and ompT proteases, significantly reduce degradation risk . The pLysS variant provides additional control of basal expression, which can reduce toxicity and associated stress responses that activate proteases.

Cultivation conditions directly impact protease activity. Lower growth temperatures (16-25°C) reduce protease activity while optimized media composition and pH can minimize stress responses. Including protease inhibitors during extraction and purification prevents degradation during downstream processing.

The fusion protein approach has proven particularly effective for protecting susceptible proteins. As demonstrated in recombinant protein studies, "fusion protein has been shown to be a successful strategy to prevent toxicity and proteolysis... and to increase their expression levels in E. coli" . This protection likely extends to AmpE production.

Targeted expression strategies can physically separate the protein from proteases. Directing expression to inclusion bodies can protect the protein from proteases if refolding is feasible, while periplasmic expression reduces exposure to cytoplasmic proteases .

Throughout purification, maintaining cold temperatures, including stabilizing agents like glycerol in buffers, and processing samples quickly all contribute to minimizing proteolytic degradation.

Experimental Design Considerations

  • How should researchers design experiments to optimize IPTG concentration and induction timing?

Experimental design for optimizing IPTG concentration and induction timing requires a systematic approach to identify conditions that maximize both yield and functionality:

A factorial experimental design should test multiple parameters simultaneously:

IPTG Concentration (mM)Cell Density at Induction (OD600)Induction Temperature (°C)Post-Induction Time (hours)
0.10.4164
0.50.8258
1.01.23716

For IPTG concentration optimization, researchers should:

  • Test concentrations ranging from 0.1-1.0 mM IPTG

  • Maintain all other parameters constant

  • Collect samples at fixed time points post-induction

  • Analyze both total and soluble protein fractions by SDS-PAGE

  • Measure specific activity of purified protein from each condition

Induction timing experiments should investigate cell density at induction:

  • Grow cultures to different OD600 values (0.4, 0.8, 1.2, 1.6)

  • Add standardized IPTG concentration

  • Monitor growth curves post-induction

  • Assess final yield and specific activity

Temperature optimization can dramatically affect folding:

  • Split cultures post-induction to different temperatures (16°C, 25°C, 37°C)

  • Monitor expression levels and solubility at each temperature

  • Analyze activity retention at different temperatures

Success has been demonstrated when "circumstances for the overproduction of recombinant protein including cell growth conditions, IPTG level, antibiotic concentration before and during IPTG induction, and cell density were optimized" . This systematic approach typically yields significant improvements over standard protocols.

  • What analytical methods should be used to assess AmpE purity and functionality?

A comprehensive analytical workflow is essential for assessing both the purity and functionality of recombinant AmpE:

For purity assessment, complementary techniques provide different insights:

SDS-PAGE analysis serves as the primary screening tool, separating proteins based on molecular weight and providing visual confirmation of purity . Densitometry analysis of stained gels can provide semi-quantitative purity estimates.

Western blot analysis using anti-His antibodies (if His-tagged) confirms the identity of the expressed protein and can detect degradation products . This technique is particularly valuable during optimization phases.

Size exclusion chromatography provides solution-state analysis of protein homogeneity, detecting aggregates and oligomeric states that might not be apparent on SDS-PAGE.

Mass spectrometry delivers precise molecular weight determination and can identify post-translational modifications or proteolytic events. This technique is essential for confirming the complete sequence integrity of the purified protein.

For functionality assessment, activity-based techniques are essential:

Enzyme activity assays specific to AmpE's biological function provide the most relevant assessment of protein quality. Similar to how "ASNase II activity was considered an index for the protein expression" in published studies , developing a quantitative activity assay for AmpE is crucial.

Circular dichroism spectroscopy assesses secondary structure integrity, providing insight into whether the recombinant protein has folded correctly.

Thermal shift assays measure protein stability, which often correlates with proper folding and activity. This high-throughput technique can rapidly compare different purification batches.

A multi-technique approach is recommended for comprehensive assessment:

TechniqueInformation ProvidedSensitivityThroughput
SDS-PAGEApparent MW, gross purityMediumHigh
Western BlotSpecific detectionHighMedium
Mass SpectrometryExact MW, modificationsVery HighLow-Medium
Activity AssayFunctional activityVariableMedium
CD SpectroscopySecondary structureMediumLow
Thermal ShiftStabilityHighHigh
  • How can researchers optimize cell lysis conditions to maximize AmpE recovery?

Optimizing cell lysis conditions is crucial for maximizing both recovery yield and biological activity of recombinant AmpE:

The choice of lysis method should be based on AmpE's subcellular localization and intrinsic stability:

For periplasmic AmpE, alkaline lysis provides gentle and selective extraction: "Periplasmic protein was extracted using an alkaline lysis method" . This approach minimizes contamination with cytoplasmic proteins while preserving activity.

For cytoplasmic AmpE, several options exist with different tradeoffs:

  • Sonication provides efficient lysis but requires optimization of amplitude, pulse cycles, and cooling to prevent heat denaturation

  • Enzymatic lysis using lysozyme followed by gentle physical disruption preserves protein activity but may introduce more contaminants

  • Mechanical disruption via French press or homogenization offers efficient lysis while maintaining lower temperatures

Buffer composition significantly impacts both extraction efficiency and protein stability:

  • pH optimization is critical, typically testing a range from 6.5-8.5

  • Salt concentration affects protein solubility and stability (typically 100-500 mM NaCl)

  • Adding reducing agents (DTT, β-mercaptoethanol) if AmpE contains cysteines

  • Including protease inhibitors to prevent degradation during extraction

A systematic optimization approach testing multiple lysis methods could be structured as:

Lysis MethodBuffer CompositionLysis EfficiencyAmpE Activity Retention
Alkaline lysis30 mM Tris-HCl, pH 8.0, 20% sucrose, 1 mM EDTATestTest
Sonication50 mM phosphate, pH 7.5, 300 mM NaCl, protease inhibitorsTestTest
Lysozyme/freeze-thaw50 mM Tris-HCl, pH 8.0, 100 mM NaCl, 1 mg/ml lysozymeTestTest
French press50 mM phosphate, pH 7.0, 200 mM NaCl, 5% glycerolTestTest

Each method should be evaluated based on both total protein recovery and specific activity of the recovered AmpE.

  • What strategies can overcome inclusion body formation during AmpE expression?

Inclusion body formation represents a common challenge in recombinant protein expression that requires a multi-faceted approach to overcome:

Expression condition optimization forms the first line of defense against inclusion bodies:

  • Reduce induction temperature to 16-25°C to slow protein synthesis and allow more time for proper folding

  • Decrease IPTG concentration to 0.1-0.5 mM instead of standard 1 mM concentrations

  • Induce at higher cell densities as mentioned in established protocols

  • Use rich media with osmotic stabilizers or specific additives (glucose, glycerol, sorbitol)

Genetic modification approaches can dramatically improve solubility:

  • Fusion with solubility-enhancing tags (MBP, SUMO, Thioredoxin, GST)

  • Codon optimization to reduce translation speed at critical folding junctions

  • Site-directed mutagenesis of problematic residues without affecting function

Chaperone co-expression assists proper protein folding:

  • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE, trigger factor)

  • Use specialized plasmids that allow controlled co-expression of multiple chaperone systems

Alternative compartmentalization can create more favorable folding environments:

  • Direct expression to the periplasm using appropriate signal sequences

  • Similar to the approach described for other proteins: "Periplasmic protein was extracted using an alkaline lysis method"

If soluble expression fails despite these approaches, refolding from inclusion bodies becomes necessary:

  • Solubilize inclusion bodies with appropriate denaturants (urea, guanidine HCl)

  • Perform controlled refolding through dilution, dialysis, or on-column refolding

  • Optimize refolding buffer conditions (pH, ionic strength, redox environment)

The effectiveness of these strategies varies based on protein characteristics:

StrategyEase of ImplementationPotential Success RateWhen to Consider
Lower temperatureEasyModerate-HighFirst approach
Reduced IPTGEasyModerateFirst approach
Fusion tagsModerateHighSecond approach
Periplasmic targetingModerateHigh for certain proteinsIf cytoplasmic expression fails
Chaperone co-expressionModerateVariableIf simple optimizations fail
Refolding from inclusion bodiesDifficultLast resortIf all soluble expression attempts fail

Troubleshooting

  • How should differences in predicted versus observed AmpE molecular weight be interpreted?

Discrepancies between predicted and observed molecular weights of recombinant AmpE require systematic investigation to identify the underlying cause:

Higher than predicted molecular weight may result from:

  • Incomplete fusion tag removal: If the purification tag wasn't completely cleaved during processing

  • Post-translational modifications: While E. coli has limited modification capabilities, some modifications can occur

  • Anomalous SDS-PAGE migration: Some proteins migrate aberrantly due to amino acid composition or residual structure

  • Oligomerization: If disulfide bridges or strong non-covalent interactions persist during SDS-PAGE

Lower than predicted molecular weight typically indicates:

  • Proteolytic degradation: Recombinant proteins can be "sensitive to the proteolytic degradation of host intracellular proteins"

  • Internal translation initiation: Alternative start codons within the sequence leading to truncated products

  • Premature translation termination: Early stop codons due to mutations or transcriptional errors

A systematic analytical approach includes:

Analytical MethodInformation ProvidedInterpretation of MW Discrepancy
Mass SpectrometryExact molecular massPrecise identification of modifications or truncations
N-terminal SequencingFirst 5-10 amino acidsConfirms correct translation start point
Western BlotTag presence/absenceDetects if tags are present as expected
Peptide MappingFragment analysisIdentifies which regions are present/absent

When higher molecular weight is observed, researchers should:

  • Verify tag removal efficiency using SDS-PAGE and Western blotting

  • Check for conditions that might promote aggregation or oligomerization

  • Use mass spectrometry to identify any post-translational modifications

For lower molecular weight observations:

  • Add protease inhibitors during purification to prevent degradation

  • Optimize expression conditions to minimize proteolysis

  • Sequence the expression construct to verify the absence of premature stop codons

  • What approaches can resolve low expression yield of recombinant AmpE?

Resolving low expression yield of recombinant AmpE requires a systematic troubleshooting approach addressing multiple aspects of protein expression:

Genetic optimization forms the foundation for improved expression:

  • Codon optimization adapts the AmpE sequence to E. coli's codon bias, enhancing translation efficiency

  • Promoter strength adjustments can fine-tune expression levels

  • Optimizing the ribosome binding site improves translation initiation

  • Testing multiple vector backbones with different copy numbers balances expression levels against metabolic burden

Host strain selection significantly impacts expression success:

  • Test multiple E. coli strains optimized for different expression characteristics

  • Protease-deficient strains like BL21(DE3) reduce degradation risk

  • Specialized strains like C41(DE3) or C43(DE3) can express toxic or challenging proteins

Expression condition optimization, as demonstrated in published protocols, includes "cell growth conditions, IPTG level, antibiotic concentration before and during IPTG induction, and cell density" :

  • Test induction at different growth phases (early, mid, and late log phase)

  • Optimize media composition (complex vs. defined media, supplementation)

  • Vary induction parameters (IPTG concentration, temperature, duration)

The fusion protein approach has proven successful for challenging proteins: "fusion protein has been shown to be a successful strategy to prevent toxicity and proteolysis... and to increase their expression levels in E. coli" . N-terminal fusion partners like MBP, SUMO, or Thioredoxin can dramatically enhance expression levels.

Potential toxicity can be addressed through:

  • Tightly regulated expression systems to minimize leaky expression

  • The pLysS system used in some expression protocols provides additional control of basal expression

  • Glucose supplementation to reduce basal expression through catabolite repression

A systematic optimization matrix helps identify optimal conditions:

ParameterTest RangeExpected Impact
E. coli strainBL21(DE3), BL21(DE3)pLysS, RosettaDifferent strains handle expression differently
VectorpET-28a, pET-22b, pMALTag position and promoter strength affect expression
Induction temp.16°C, 25°C, 37°CLower temperatures often improve expression
IPTG conc.0.1 mM, 0.5 mM, 1.0 mMOptimal concentration depends on protein characteristics
MediaLB, TB, 2×YTNutritional environment affects expression capacity
OD600 at induction0.4, 0.8, 1.2Cell density impacts metabolic state during induction
  • How can researchers design experiments to characterize AmpE protein stability and storage conditions?

Designing experiments to characterize AmpE stability and optimize storage conditions requires systematic evaluation of multiple environmental factors:

Thermal stability assessment provides foundational understanding:

  • Differential Scanning Fluorimetry (DSF) measures melting temperature (Tm) across different buffer conditions

  • Circular Dichroism (CD) with temperature ramping monitors secondary structure changes during thermal denaturation

  • Activity assays after thermal stress directly measure functional retention

pH sensitivity characterization is essential for buffer optimization:

  • Test AmpE stability across pH range 4.0-9.0 at intervals of 0.5 pH units

  • Monitor activity retention after incubation at different pH values

  • Combine with thermal stability tests to identify pH-dependent stability changes

Buffer component optimization requires testing:

  • Salt type and concentration (NaCl, KCl at 0-500 mM)

  • Stabilizing additives (glycerol, sucrose, trehalose at 5-20%)

  • Reducing agents if AmpE contains cysteines (DTT, β-mercaptoethanol, TCEP)

  • Chelating agents if metal-dependent (EDTA, EGTA)

Long-term storage condition optimization should test:

  • Different temperatures (4°C, -20°C, -80°C)

  • Flash freezing vs. slow freezing protocols

  • Effect of multiple freeze-thaw cycles on activity

  • Lyophilization with different cryoprotectants

A comprehensive stability matrix approach would systematically test combinations:

ParameterTest RangeAnalytical MethodStability Indicator
Temperature4°C, 25°C, 37°CActivity assay at 24h, 48h, 1 week% Activity retention
pH6.0, 6.5, 7.0, 7.5, 8.0DSF for Tm, Activity after 24hTm shift, % Activity
NaCl (mM)0, 150, 300, 500DSF, Activity after stressTm, % Activity
Glycerol (%)0, 5, 10, 20Freeze-thaw recovery% Activity after cycles
Storage formSolution, Frozen, LyophilizedActivity after 1, 3, 6 monthsLong-term stability

The optimal formulation and storage conditions would maximize both stability and activity retention over the required timeframe. Similar approaches have been used successfully for other recombinant proteins expressed in E. coli .

  • What are the most effective approaches for scaling up AmpE production for structural studies?

Scaling up AmpE production for structural studies requires strategies that maintain protein quality while increasing yield:

Bioreactor cultivation offers significant advantages over shake flasks:

  • Precise control of dissolved oxygen, pH, and nutrient feeding

  • Ability to reach much higher cell densities (OD600 >50 compared to ~5 in flasks)

  • Implementation of fed-batch strategies to minimize acetate formation

  • Real-time monitoring and adjustment of cultivation parameters

Fermentation strategy optimization is crucial:

  • Batch cultivation: Simple but limited by nutrient availability

  • Fed-batch cultivation: Controlled nutrient feeding maintains optimal growth

  • High-density cultivation: Maximizes biomass and potential protein yield

Media optimization for scale-up differs from laboratory-scale:

  • Defined media facilitates process control and reproducibility

  • Carbon source feeding strategies prevent overflow metabolism

  • Addition of trace elements and vitamins supports high-density growth

  • Antibiotic stability during long fermentations must be considered

Induction strategies require refinement for scale-up:

  • Auto-induction media eliminates need for manual IPTG addition

  • Reduced temperature after induction improves soluble protein fraction

  • Extended expression times at lower temperatures can increase total yield

Downstream processing must be adapted for larger volumes:

  • Continuous centrifugation replaces batch centrifugation for cell harvesting

  • Expanded bed adsorption chromatography can process unclarified lysate

  • Tangential flow filtration for buffer exchange and concentration

  • Scale-up of affinity chromatography with larger columns or multiple cycles

The application of this optimized protocol has shown "protein production was significantly enhanced in comparison to the traditional IPTG induction method in the absence of a fermentor" , suggesting that careful optimization can yield substantial improvements even without specialized equipment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.