Recombinant Escherichia coli Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
crcB; ECSE_0692; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Escherichia coli (strain SE11)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTAH
Uniprot No.

Target Background

Function

Important for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the known functions of CrcB in Escherichia coli?

CrcB in E. coli has been experimentally demonstrated to play several important roles:

  • Chromosome protection: In conjunction with crcA and cspE, CrcB protects the chromosome from decondensation by camphor

  • DNA topology regulation: Overexpression increases supercoiling levels of plasmids in both wild-type cells and temperature-sensitive gyrase mutants

  • Antibiotic resistance: Suppresses sensitivity to nalidixic acid in gyrase and topoisomerase IV temperature-sensitive mutants

  • Nucleoid morphology maintenance: Corrects nucleoid morphology defects in topoisomerase IV temperature-sensitive mutants

  • Fluoride ion transport: Functions as a putative fluoride ion transporter

Notably, when CrcB is overexpressed with cspE, it confers 100-fold camphor resistance and 2.1-fold induction of rcsA, suggesting a synergistic relationship between these proteins .

What are the optimal conditions for recombinant expression of E. coli CrcB protein?

For optimal expression of recombinant E. coli CrcB protein, the following methodology is recommended:

Expression System Selection:

  • E. coli is the preferred expression system due to the protein's bacterial origin

  • For complex modifications, consider alternative systems like yeast, baculovirus/insect cells, or mammalian cells

Vector Design:

  • Include an N-terminal or C-terminal His-tag for purification purposes

  • Ensure the presence of a strong promoter (like T7) for high-level expression

  • Consider codon optimization if expressing in a different host

Expression Conditions:

  • Induction with IPTG at a concentration of 0.1-1.0 mM

  • Expression temperature: 16-25°C to prevent inclusion body formation

  • Expression duration: 4-16 hours depending on temperature

Lysis and Extraction:

  • For membrane proteins like CrcB, use detergent-based extraction

  • Common detergents: n-Dodecyl β-D-maltoside (DDM), CHAPS, or Triton X-100

  • Include protease inhibitors to prevent degradation

Successful expression can be verified by SDS-PAGE analysis, with expected purity greater than 90% .

How should recombinant CrcB be stored to maintain stability and activity?

For optimal stability and activity maintenance of recombinant CrcB protein, follow these storage recommendations:

Short-term Storage (up to one week):

  • Store working aliquots at 4°C

  • Avoid repeated freeze-thaw cycles

Long-term Storage:

  • Store at -20°C or preferably -80°C

  • Aliquot before freezing to avoid repeated freeze-thaw cycles

  • Recommended storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Add glycerol to a final concentration of 5-50% (optimal: 50%)

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to desired final concentration

  • Aliquot for long-term storage

These storage conditions have been shown to maintain protein stability while minimizing degradation and loss of activity .

What experimental approaches can be used to study the role of CrcB in DNA topology and chromosome protection?

To investigate CrcB's role in DNA topology and chromosome protection, researchers can employ the following methodological approaches:

Overexpression and Deletion Studies:

  • Generate strains with controlled expression of crcB (alone or with crcA and cspE)

  • Compare phenotypes under normal and stress conditions (e.g., camphor exposure)

  • Analyze nucleoid morphology using DAPI staining and fluorescence microscopy

Plasmid Supercoiling Analysis:

  • Extract plasmid DNA from strains with different CrcB expression levels

  • Perform agarose gel electrophoresis with chloroquine to separate topoisomers

  • Quantify supercoiling density changes

Interaction with DNA-binding Proteins:

  • Use co-immunoprecipitation to identify protein-protein interactions

  • Perform ChIP (Chromatin Immunoprecipitation) to analyze DNA-binding patterns

  • Apply ChIP-chip methodology as described for other DNA-binding proteins

Antibiotic Resistance Testing:

  • Determine minimum inhibitory concentrations (MICs) of nalidixic acid

  • Assess survival rates under antibiotic challenge

  • Monitor growth curves of wild-type versus CrcB-modified strains

Nucleoid Morphology Assessment:

  • Use fluorescence microscopy with DNA stains

  • Quantify nucleoid area, density, and shape parameters

  • Apply super-resolution microscopy techniques for detailed structural analysis

How does CrcB function in conjunction with other proteins like crcA and cspE?

CrcB functions synergistically with crcA and cspE to maintain chromosome integrity and cell viability. The experimental data reveals the following functional relationships:

Synergistic Effects:

  • When CrcB is overexpressed with cspE, it confers 100-fold camphor resistance, compared to just 10-fold resistance with cspE alone

  • The combination leads to 2.1-fold induction of rcsA, versus 1.7-fold with cspE alone

Functional Redundancy and Complementation:

  • Deletion of all three genes (crcA, cspE, and crcB) is not lethal but increases sensitivity to camphor

  • Individual deletions have less severe phenotypes, suggesting partial functional redundancy

Biochemical Mechanisms:

  • cspE is a cold-shock protein with RNA chaperone activity

  • CrcB appears to function in membrane processes and possibly ion transport

  • The combination affects DNA topology and nucleoid organization

Experimental Approach to Study Interactions:

  • Generate single, double, and triple deletion/overexpression strains

  • Perform epistasis analysis by measuring phenotypes in different genetic backgrounds

  • Use fluorescence resonance energy transfer (FRET) to detect physical interactions

  • Apply transcriptomics to identify coordinately regulated genes

How can researchers design experiments to elucidate the mechanism of CrcB in fluoride ion transport?

To investigate CrcB's putative role as a fluoride ion transporter, researchers should consider this comprehensive experimental design approach:

In Vitro Transport Assays:

  • Reconstitute purified CrcB in liposomes

  • Use fluoride-sensitive probes (e.g., PBFI) to monitor ion movement

  • Perform kinetic analysis under various conditions (pH, temperature, concentration gradients)

  • Test specificity by comparing transport rates of fluoride versus other ions

Structural Studies:

  • Use X-ray crystallography or cryo-EM to determine CrcB's 3D structure

  • Perform molecular dynamics simulations to identify potential ion-binding sites

  • Apply mutagenesis to validate key residues involved in ion coordination

Cellular Fluoride Sensitivity:

  • Design a completely randomized design (CRD) experiment with the following factors:

    • CrcB expression level (wild-type, overexpression, deletion)

    • Fluoride concentration (multiple levels)

    • Growth conditions (pH, temperature)

  • Measure growth rates, survival, and intracellular fluoride concentrations

Example Experimental Design Table:

Treatment GroupCrcB StatusFluoride Concentration (mM)Replicates
1Wild-type05
2Wild-type55
3Wild-type105
4Overexpression05
5Overexpression55
6Overexpression105
7Deletion05
8Deletion55
9Deletion105

Data should be analyzed using analysis of variance (ANOVA) following the guidelines for experimental design and analysis as detailed in IIT Kanpur's guide on experimental designs .

What are the most effective methods to study CrcB's impact on bacterial stress responses?

To comprehensively investigate CrcB's role in bacterial stress responses, researchers should employ a multilayered experimental approach:

Global Expression Analysis:

  • Perform RNA-Seq on wild-type and CrcB-modified strains under various stress conditions:

    • Oxidative stress (H₂O₂, paraquat)

    • Membrane stress (camphor, detergents)

    • Antibiotic exposure (nalidixic acid)

    • Temperature stress (heat shock, cold shock)

  • Identify differentially expressed genes and pathways

Phenotypic Microarray Analysis:

  • Use Biolog plates to assess growth under hundreds of stress conditions

  • Compare metabolic profiles of wild-type and CrcB-modified strains

  • Identify specific conditions where CrcB confers advantage/disadvantage

Proteomic Approaches:

  • Perform quantitative proteomics using techniques like iTRAQ or TMT

  • Identify changes in protein expression and post-translational modifications

  • Use protein-protein interaction studies to map CrcB's interactome

Membrane Integrity Assessment:

  • Measure membrane potential using voltage-sensitive dyes

  • Assess membrane permeability with fluorescent probes

  • Analyze membrane lipid composition by mass spectrometry

In Vivo Imaging:

  • Create fluorescent protein fusions to track CrcB localization during stress

  • Perform time-lapse microscopy to monitor dynamic responses

  • Correlate CrcB localization with nucleoid morphology changes

Statistical Analysis Framework:
For complex multi-factor experiments, use randomized block design (RBD) analysis to account for experimental variation, as described in the experimental design literature .

How do different E. coli strains vary in their CrcB protein sequence and function?

The variation in CrcB protein sequences across E. coli strains provides important insights into functional conservation and adaptation. Here's a methodological approach to studying these variations:

Comparative Sequence Analysis:
Based on the available data, CrcB proteins from different E. coli strains show high sequence conservation with only minor variations. For example:

E. coli StrainUniProt IDSequence VariationPosition
O17:K52:H18B7N9N0L → L (no change)86
O6:K15:H31Q0TK48L → F86
55989/EAECB7L9G9L → F86

Functional Comparison Methods:

  • Express CrcB variants from different strains in a common genetic background

  • Perform complementation assays in CrcB deletion strains

  • Compare phenotypes under stress conditions (especially camphor resistance)

  • Measure fluoride transport capacity across variants

Evolutionary Analysis:

  • Construct phylogenetic trees based on CrcB sequences

  • Correlate sequence variations with strain pathogenicity or ecological niche

  • Calculate selection pressure (dN/dS ratios) on different protein regions

  • Identify co-evolving residues that may be functionally linked

Structure-Function Prediction:

  • Use homology modeling to predict structural differences between variants

  • Identify whether variations occur in predicted functional domains

  • Design hybrid proteins to map functional domains

  • Test predictions through site-directed mutagenesis

How can CrcB research in E. coli be extended to study homologs in other bacterial species?

The study of CrcB homologs across bacterial species requires a systematic approach combining comparative genomics, functional analysis, and evolutionary perspectives:

Cross-Species Homolog Identification:

  • Perform BLAST searches using E. coli CrcB as query against bacterial genomes

  • Apply Hidden Markov Models (HMMs) to identify distant homologs

  • Construct multiple sequence alignments to identify conserved domains

  • The search results indicate CrcB homologs exist in diverse species including Campylobacter fetus (128aa), Campylobacter jejuni (122aa), and Nostoc sp.

Heterologous Expression Strategy:

  • Clone CrcB homologs from target species (e.g., Campylobacter)

  • Express in E. coli CrcB deletion strains

  • Assess functional complementation

  • Compare phenotypes under various stress conditions

Comparative Functional Analysis:

  • Generate deletion mutants in multiple species where possible

  • Compare phenotypes under standardized conditions

  • Assess species-specific functions that may have evolved

Experimental Controls Table:

Bacterial SpeciesExpression SystemPositive ControlNegative ControlExpected Size
E. coliNativeWild-type strainΔcrcB strain127aa (~14kDa)
Campylobacter fetusE. coliC. fetus extractΔcrcB E. coli128aa (~14kDa)
Campylobacter jejuniE. coliC. jejuni extractΔcrcB E. coli122aa (~13kDa)
Nostoc sp.E. coliNostoc extractΔcrcB E. coliPartial (~17kDa)

Community-Based Research Approaches:
To maximize research impact, consider employing capacity-bridging models where diverse research teams collaborate, as recommended by the Pacific AIDS Network for community-based research .

What recombinant protein expression systems are most suitable for studying CrcB homologs from different bacterial sources?

The selection of an appropriate expression system for CrcB homologs from diverse bacterial sources requires careful consideration of protein characteristics and experimental goals:

Expression System Comparison:

Expression SystemAdvantagesLimitationsBest For
E. coli- High yield
- Simple cultivation
- Cost-effective
- Rapid expression
- Limited post-translational modifications
- Inclusion body formation possible
- Endotoxin contamination
CrcB homologs from closely related bacteria
Yeast (P. pastoris)- Eukaryotic post-translational modifications
- Secretion possible
- High cell density
- Longer expression time
- More complex media
- Different codon usage
CrcB requiring specific modifications
Baculovirus/Insect cells- Complex eukaryotic processing
- High expression levels
- Proper folding
- Technical complexity
- Higher cost
- Longer timeline
CrcB with complex structural requirements
Mammalian cells- Most advanced modifications
- Native-like folding
- Minimal immunogenicity
- Highest cost
- Most complex
- Lower yields
When absolute native conformation is critical

Methodology for System Selection:

  • Analyze the target CrcB sequence for:

    • Predicted transmembrane domains

    • Post-translational modification sites

    • Potential toxicity to host

  • Perform small-scale expression trials in multiple systems

  • Evaluate protein solubility, activity, and yield

  • Scale up the most promising system

These recommendations are based on the established protein expression systems described by the Helmholtz Centre for Infection Research , while considering the specific characteristics of CrcB homologs from different bacterial sources .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.