Recombinant Escherichia coli Protein CrcB (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us; we will prioritize its development.
Synonyms
crcB; ybeI; b0624; JW0619; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTAH
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Note=Could be a dual-topology protein, which inserts into the membrane in two opposite orientations. May form an antiparallel homodimer in the inner membrane.

Q&A

What is E. coli Protein CrcB and what are its primary functions in bacterial physiology?

CrcB is a membrane protein in E. coli that functions primarily as a fluoride transporter, playing a crucial role in fluoride resistance mechanisms. The protein reduces intracellular fluoride concentration by exporting fluoride ions from the cell, thereby protecting against fluoride toxicity . Additionally, research has shown that CrcB, along with CrcA and CspE, can confer camphor resistance when present in high copy numbers . CrcB is also implicated in chromosomal structural integrity, as overexpression of these genes can suppress mutations in the chromosomal partition gene mukB by promoting or protecting chromosome folding .

How is the crcB gene organized within the bacterial genome and how is its expression regulated?

The crcB gene in E. coli is typically organized within an operon structure. Based on research in Enterobacter cloacae FRM (a related organism), crcB is found in a six-gene operon that includes ppaC, uspA, eno, gpmA, crcB, and orf5249 . This operon arrangement is significant for coordinated gene expression during stress response.

Expression of the crcB gene is regulated by a fluoride riboswitch, a specialized RNA structure located upstream of the operon that acts as a sensing and regulatory element . When fluoride ions are present, the riboswitch undergoes conformational changes that activate transcription of the downstream genes. Quantitative RT-PCR studies have demonstrated that exposure to fluoride can increase crcB expression approximately 10-fold compared to baseline levels .

What methodologies are most effective for initial characterization of CrcB function?

For initial characterization of CrcB function, researchers should consider a multi-faceted approach:

  • Gene knockout studies: Creating crcB deletion mutants (ΔcrcB) and assessing phenotypic changes, particularly in response to fluoride challenge .

  • Complementation experiments: Reintroducing the wild-type crcB gene or its variants into knockout strains to confirm functional restoration .

  • Fluoride sensitivity assays: Determining minimum inhibitory concentrations (MICs) of fluoride for wild-type versus mutant strains through standardized growth inhibition tests .

  • Expression analysis: Using quantitative RT-PCR to measure crcB expression levels under various conditions, particularly in response to fluoride exposure .

  • Transport assays: Measuring fluoride ion movement across the membrane in cells expressing or lacking CrcB to directly assess transporter function.

What are the optimal conditions for expressing recombinant CrcB protein in E. coli systems?

Recombinant CrcB expression requires careful optimization due to its membrane protein nature, which often presents challenges for soluble expression. Based on established protocols for similar membrane proteins:

  • E. coli strain selection: BL21(DE3) derivatives such as C41(DE3) and C43(DE3) are recommended for toxic or membrane proteins as they contain mutations in the lacUV5 promoter that reduce expression rates to more tolerable levels for the host cell .

  • Expression vector choice: pET series vectors with the T7 promoter system offer controlled expression that can represent up to 50% of total cell protein in successful cases . For membrane proteins like CrcB, vectors with tightly regulated promoters are essential to prevent toxicity.

  • Induction parameters:

    • Temperature: Lower temperatures (15-25°C) often improve membrane protein folding and incorporation

    • Inducer concentration: Using lower IPTG concentrations (<0.1 mM) for T7-based systems can reduce toxicity effects

    • Growth phase: Induction at higher cell densities (mid-log phase) may improve yields

  • Media components: Supplementation with glycerol (0.5-2%) can sometimes improve membrane protein expression by providing additional carbon source and membrane components.

How can researchers mitigate the metabolic burden associated with CrcB overexpression?

Mitigating metabolic burden during CrcB expression is critical for achieving viable cells and optimal protein yields. Research has shown that recombinant protein expression creates stress not through energy limitations, but rather through accumulation of ATP and precursors of glycolysis, leading to an unbalanced metabolic repertoire . Strategies to address this include:

  • Control expression rate: Use weaker or tightly regulated promoters that enable more precise tuning of polymerase activity .

  • Decouple cell growth from protein production: Systems like BL21-AI<gp2> allow independent control of host cell metabolism and recombinant protein expression through a phage-derived inhibitor peptide that blocks E. coli RNA polymerase but not T7 RNA polymerase .

  • Optimize induction timing: The timing of protein synthesis induction plays a critical role in the fate of recombinant proteins within host cells, affecting protein and product yield . Early induction can overwhelm the cellular machinery, while late induction may provide insufficient time for protein accumulation.

  • Balance translation resources: Recent research suggests that a stable ratio between exogenous and endogenous mRNA is crucial for maintaining cell viability. Excessive amounts of exogenous mRNA from overexpressed genes can outcompete endogenous mRNA, impairing synthesis of essential host proteins .

  • Amino acid supplementation: Supplementing growth media with amino acids can help alleviate translational limitations and reduce misincorporation of non-canonical amino acids, particularly during high-density fermentation .

What purification approaches are most effective for obtaining functional CrcB protein?

Purification of membrane proteins like CrcB requires specialized approaches:

  • Affinity tagging strategy: N-terminal His-tagging has been successfully employed for CrcB homologs . This approach facilitates purification while minimizing interference with protein function, as evidenced by the successful expression and purification of the CrcB homolog from Prochlorococcus marinus .

  • Membrane extraction: Effective solubilization requires screening multiple detergents (e.g., DDM, LDAO, FC-12) at various concentrations to identify optimal conditions that maintain protein stability and function.

  • Buffer optimization: For membrane proteins like CrcB, buffers containing stabilizing agents such as glycerol (5-10%) and specific lipids may improve protein stability during purification.

  • Quality control assessment: Use size exclusion chromatography to evaluate protein homogeneity and assess proper folding through functional assays specific to fluoride transport capability.

  • Storage considerations: CrcB proteins are typically stored in detergent-containing buffers with 6% trehalose at pH 8.0 to maintain stability, with aliquoting and storage at -80°C recommended to avoid repeated freeze-thaw cycles .

How does CrcB interface with other proteins in the fluoride resistance operon to provide comprehensive protection?

The functional cooperation between CrcB and other proteins in the fluoride resistance operon represents a sophisticated bacterial defense mechanism. Analysis of the six-gene operon in E. cloacae FRM has revealed a coordinated system where:

  • CrcB: Functions as the fluoride transporter, directly exporting fluoride ions from the cell .

  • PpaC (Pyrophosphatase): Catalyzes essential reactions in nucleic acid synthesis and is inhibited by fluoride. Increased expression likely compensates for reduced enzyme activity in the presence of fluoride .

  • Eno (Enolase): A glycolytic enzyme inhibited by fluoride. Its overexpression helps maintain glycolytic flux despite fluoride inhibition .

  • UspA (Universal Stress Protein A): Produced in response to a variety of stress conditions, providing general stress protection .

  • GpmA (Phosphoglycerate mutase): Another glycolytic enzyme that works in concert with Eno to maintain energy production .

What are the structural determinants of CrcB that enable selective fluoride transport?

While detailed structural information specific to E. coli CrcB is limited in the provided search results, functional studies suggest several key features:

  • Transmembrane topology: CrcB is a membrane protein with multiple transmembrane domains that form a channel or pore through which fluoride ions are transported .

  • Selectivity filter: The protein must contain residues that specifically recognize fluoride ions while excluding other halides and anions of similar size.

  • Fluoride binding sites: These are likely composed of positively charged amino acids or hydrogen bond donors that can interact with the highly electronegative fluoride ion.

  • Conformational changes: The protein likely undergoes structural rearrangements during the transport cycle to alternately expose the binding site to either side of the membrane.

Research on related fluoride channels has shown that these proteins function to export fluoride to protect bacteria against its toxicity . Further structural studies using techniques such as X-ray crystallography or cryo-electron microscopy would be valuable for elucidating the precise molecular mechanisms of fluoride selectivity and transport.

How does the expression profile of CrcB change under different stress conditions beyond fluoride exposure?

While the fluoride-responsive nature of CrcB expression is well-established through the fluoride riboswitch mechanism , the search results also indicate that CrcB may respond to other stressors:

  • Camphor exposure: High copy expression of crcB, along with crcA and cspE, confers resistance to camphor, suggesting that CrcB expression may be modulated in response to this compound .

  • Chromosomal stress: The role of CrcB in suppressing mutations in the chromosomal partition gene mukB indicates potential involvement in the response to DNA damage or chromosomal structural abnormalities .

  • Relationship to cold shock response: The genetic association of crcB with cspE (a cold shock-like protein with homologues in all organisms tested) suggests possible co-regulation under cold stress conditions .

Researchers investigating CrcB expression profiles would benefit from conducting comprehensive transcriptomic and proteomic analyses under various stress conditions to fully elucidate its regulatory network and stress response functions.

What strategies can researchers employ when facing CrcB toxicity during recombinant expression?

Membrane proteins like CrcB can pose toxicity challenges during recombinant expression. Research-backed approaches to address this include:

  • Strain selection for toxic proteins: Use specialized strains like C41(DE3) and C43(DE3), which were specifically isolated for their ability to withstand the expression of toxic proteins. These strains contain mutations in the lacUV5 promoter that revert it to a weaker wild-type version, reducing expression to more tolerable levels .

  • Secretion strategies: Consider fusing CrcB to leader peptides that direct secretion to the periplasm, such as DsbA, which utilizes the SRP pathway for co-translational translocation. This approach has been successful for other challenging proteins .

  • Regulated expression systems: Employ tightly controlled expression systems:

    • T7 lysozyme co-expression (using pLysS or pLysE plasmids) to inhibit basal T7 RNAP activity

    • Arabinose-inducible (pBAD) systems that provide positive control and lower background expression

    • Cold-inducible promoters like cspA, which are activated by temperature downshift to 15°C

  • Codon optimization: Optimize the crcB coding sequence for E. coli expression while avoiding excessive GC content or rare codons that might cause translational pausing.

  • Expression tuning: Rather than maximizing expression, aim for optimized expression levels that balance protein yield with cell viability:

    • Use lower inducer concentrations

    • Test various induction times and durations

    • Consider auto-induction media that provide gradual induction

How can researchers resolve issues with CrcB aggregation and inclusion body formation?

Membrane proteins frequently form inclusion bodies during recombinant expression. Based on current research in protein expression:

  • Solubility enhancement strategies:

    • Lower the expression temperature to 15-25°C to slow down protein synthesis and allow proper folding

    • Co-express molecular chaperones like GroEL/GroES, DnaK/DnaJ/GrpE, or membrane-specific chaperones

    • Use fusion partners known to enhance membrane protein solubility

  • Inclusion body processing approaches:

    • Recover functional protein from inclusion bodies through optimized solubilization and refolding protocols

    • Use mild detergents rather than chaotropic agents for initial solubilization attempts

    • Perform on-column refolding by immobilizing the denatured protein on affinity resin before refolding

  • Experimental design considerations:

    • Implement high-throughput screening of expression conditions using different E. coli strains, media compositions, and induction parameters

    • Use GFP-fusion screening approach to rapidly identify conditions that yield properly folded protein

    • Consider cell-free expression systems for difficult-to-express membrane proteins

  • Buffer optimization:

    • Screen various detergents and lipids to identify conditions that stabilize the native conformation

    • Test addition of specific ligands or substrates (like fluoride analogs) that might stabilize the protein structure

The search results indicate that controlling the expression rate is often more beneficial than maximizing it, as excessive expression can overwhelm the cellular folding machinery and promote aggregation .

What analytical methods are most appropriate for assessing CrcB transport activity?

To effectively measure CrcB fluoride transport activity, researchers should consider these analytical approaches:

  • Growth-based fluoride sensitivity assays:

    • Determine minimum inhibitory concentrations (MICs) of fluoride for strains expressing wild-type CrcB versus mutant variants or empty vector controls

    • Conduct growth curve analysis in the presence of varying fluoride concentrations

    • Perform spot assays on solid media containing different fluoride concentrations

  • Direct fluoride transport measurements:

    • Use fluoride-selective electrodes to measure changes in fluoride concentration in different compartments

    • Employ fluorescent probes sensitive to fluoride concentration for real-time monitoring

    • Consider liposome reconstitution assays with purified CrcB to measure transport in a controlled system

  • Structural and binding studies:

    • Utilize isothermal titration calorimetry (ITC) to measure binding affinity of fluoride to purified CrcB

    • Perform fluoride competition assays to assess binding specificity

    • Use circular dichroism (CD) spectroscopy to monitor structural changes upon fluoride binding

  • Advanced cellular techniques:

    • Develop fluorescent reporter systems linked to intracellular fluoride concentration

    • Use electrophysiological methods to measure ion currents in cells or membrane patches expressing CrcB

    • Employ fluorescence microscopy to track the subcellular localization of CrcB under various conditions

Research in E. cloacae FRM has successfully employed growth-based assays in liquid and solid media with varying fluoride concentrations (up to 4,000 mg/L) to assess the function of CrcB and related proteins in the fluoride resistance operon .

How might CrcB function be applied in synthetic biology and biotechnological applications?

The fluoride transport capabilities of CrcB present several promising applications in synthetic biology and biotechnology:

  • Biosensors and biomonitoring:

    • Development of whole-cell biosensors for environmental fluoride detection

    • Creation of genetic circuits that respond to fluoride concentration through the fluoride riboswitch mechanism

    • Engineering reporter systems that visualize fluoride transport in real-time

  • Bioremediation applications:

    • Engineering microorganisms with enhanced fluoride accumulation or detoxification capabilities for environmental cleanup

    • Development of biofilters containing CrcB-expressing bacteria for water treatment

  • Industrial biotechnology:

    • Improving microbial tolerance to fluoride in industrial processes where fluoride may be present as a contaminant

    • Engineering production strains with enhanced resistance to fluoride-containing antibiotics or selective agents

  • Protein engineering opportunities:

    • Modification of CrcB to transport other halides or toxic ions

    • Development of chimeric transporters with novel specificities

    • Creation of controllable membrane channels based on CrcB structure

The fluoride riboswitch that regulates crcB expression could also be repurposed as a molecular tool for controlled gene expression in synthetic biology applications .

What comparative genomics approaches might reveal about CrcB evolution and specialization across bacterial species?

Comparative genomics offers valuable insights into the evolutionary history and functional diversification of CrcB:

  • Phylogenetic analysis:

    • Construction of evolutionary trees based on CrcB sequences across bacterial phyla

    • Identification of conserved domains and variable regions that may relate to species-specific functions

    • Analysis of selective pressures acting on different regions of the protein

  • Operon structure comparison:

    • Examination of how the genomic context of crcB varies across species

    • Analysis of the conservation of the six-gene operon structure found in E. cloacae

    • Investigation of alternative regulatory mechanisms in species lacking the fluoride riboswitch

  • Function-structure relationships:

    • Correlation between CrcB sequence variations and fluoride resistance levels across species

    • Analysis of species-specific adaptations in CrcB structure in environments with different fluoride exposure

    • Comparative analysis of CrcB and other fluoride transporters like EriCF

  • Horizontal gene transfer assessment:

    • Investigation of whether crcB genes have been horizontally transferred between bacterial species

    • Analysis of genomic islands containing crcB, similar to the GI3 island in E. cloacae FRM

The search results indicate that CrcB homologs exist across diverse bacterial species, including distant relatives like Prochlorococcus marinus , suggesting ancient evolutionary origins and potential functional conservation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.