Recombinant Escherichia coli Protein damX (damX)

Shipped with Ice Packs
In Stock

Description

Structure of DamX

DamX is highly conserved in E. coli and Salmonella, sharing approximately 77% identity . The protein is found in the inner membrane of both dividing and non-dividing cells and has a predicted size of 46 kDa, although it migrates slower than expected in SDS polyacrylamide gels . DamX contains a single transmembrane segment, an N-terminal cytoplasmic domain of around 100 amino acid residues, and a relatively large, unstructured C-terminal periplasmic domain of about 300 amino acids .

A conserved peptidoglycan-binding domain, known as the SPOR domain, is present at the C-terminus of DamX . SPOR domains are found in some septal ring components and are crucial for septal ring localization .

Regulation of damX Expression

Transcription of damX in E. coli is driven by at least three promoters: P1, P2, and P3 . All three promoters resemble a classical σ70-dependent promoter . P1 and P2 are located upstream of aroK, while P3 is inside the aroB coding sequence . P2 is the strongest promoter, followed by P1 and P3, which suggests that P1 and P2 ensure basal expression levels of the entire operon, while P3 modulates the expression level of downstream genes . Two additional promoters (P4 and P5) have been identified in the E. coli damX-containing operon, but neither contributes to damX transcription .

Function of DamX

DamX has roles in cell division and bile resistance . Studies have shown that DamX interacts strongly with itself, FtsQ, and FtsN, all of which are SPOR domain-containing cell division proteins .

Cytokinesis and Cell Division

DamX has been implicated in cell division, particularly in the maturation of the Z ring, a structure essential for bacterial cell division . Overproduction of DamX can lead to a filamentous phenotype, suggesting its involvement in cell division regulation . It has been observed that DamX requires its SPOR domain for proper localization to the septum and function in cell division .

During filamentation, DamX initially exhibits a dissipated localization around the whole membrane, potentially sequestering division proteins or directly inhibiting division throughout the filament's length . Subsequently, DamX switches function to assist in cell division, structurally resembling normal cell division .

Bile Resistance

DamX contributes to bile resistance in E. coli and Salmonella . Many bile-sensitive mutants exhibit defects in envelope integrity; as an inner membrane protein present in both dividing and non-dividing cells, DamX may contribute to maintaining envelope integrity in addition to its role in cytokinesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
damX; yhfB; b3388; JW3351; Cell division protein DamX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
damX
Target Protein Sequence
MDEFKPEDELKPDPSDRRTGRSRQSSERSERTERGEPQINFDDIELDDTDDRRPTRAQKE RNEEPEIEEEIDESEDETVDEERVERRPRKRKKAASKPASRQYMMMGVGILVLLLLIIGI GSALKAPSTTSSDQTASGEKSIDLAGNATDQANGVQPAPGTTSAENTQQDVSLPPISSTP TQGQTPVATDGQQRVEVQGDLNNALTQPQNQQQLNNVAVNSTLPTEPATVAPVRNGNASR DTAKTQTAERPSTTRPARQQAVIEPKKPQATVKTEPKPVAQTPKRTEPAAPVASTKAPAA TSTPAPKETATTAPVQTASPAQTTATPAAGAKTAGNVGSLKSAPSSHYTLQLSSSSNYDN LNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPL RQVQADLK
Uniprot No.

Target Background

Function
Non-essential cell division protein.
Gene References Into Functions
  1. Studies on murine infections demonstrate DamX's crucial role in establishing robust urinary tract infections, highlighting its function as a virulence mediator. PMID: 27486187
Database Links
Protein Families
DamX family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is damX protein and what are its key structural features?

DamX is a 46 kDa protein found in Escherichia coli and Salmonella enterica that plays important roles in bacterial cell membrane integrity and bile resistance. The protein contains a peptidoglycan-binding SPOR domain, which is critical for its localization and function. This domain enables damX to interact with the bacterial cell wall components, particularly at the septal region during cell division. The protein's structural analysis reveals that it is an inner membrane protein with domains extending into both the periplasm and cytoplasm, allowing it to coordinate multiple cellular functions .

What is the genomic context of the damX gene in E. coli?

The damX gene in E. coli is situated within an operon containing genes with diverse functions. This operon includes genes involved in DNA adenine methylation, biosynthesis of aromatic compounds, carbohydrate metabolism, and tRNA charging. This genomic organization suggests that damX expression may be coordinated with these other cellular processes, indicating potential regulatory relationships or functional coordination. The proximity to genes with such heterogeneous functions highlights the complex integration of damX into multiple cellular pathways .

What phenotypes are associated with damX mutations in E. coli?

E. coli mutants lacking functional damX protein display increased sensitivity to bile, similar to the phenotype observed in Salmonella enterica damX mutants. This bile sensitivity indicates that damX plays a significant role in maintaining membrane integrity and resistance to detergent-like substances. Additionally, the disruption of damX may affect cell division processes due to its accumulation at the septal ring during division. Researchers should examine changes in cell morphology, division patterns, and susceptibility to various membrane-disrupting agents when characterizing damX mutants .

How should researchers design experiments to study damX function in bacterial cell division?

When designing experiments to investigate damX's role in cell division, researchers should implement a multi-faceted approach:

  • Microscopy-based analysis: Utilize fluorescently-tagged damX to visualize its localization during different stages of cell division. Time-lapse microscopy with co-localization studies involving other division proteins can provide insights into temporal dynamics.

  • Growth curve analysis: Compare wild-type and damX mutant strains under various growth conditions, measuring parameters such as doubling time, lag phase duration, and maximum optical density.

  • Septal ring component analysis: Examine interactions between damX and other septal ring proteins using techniques such as bacterial two-hybrid assays, co-immunoprecipitation, or fluorescence resonance energy transfer (FRET).

  • Peptidoglycan synthesis assessment: Measure incorporation of labeled peptidoglycan precursors at the division site in wild-type versus damX mutant backgrounds.

The experimental design should follow the true experimental design principles outlined by Campbell and Stanley, including appropriate control groups and randomization to minimize threats to internal validity .

What are optimal methods for expressing recombinant damX protein in E. coli?

For efficient expression of recombinant damX protein in E. coli, researchers should consider the following methodological approach:

  • Promoter selection: The choice of promoter significantly impacts expression levels. While standard T7 promoters in pET vectors are commonly used, consider engineered promoters with enhanced activity. The insertion of additional Shine-Dalgarno (SD) sequences between the promoter and target gene can significantly increase expression levels, as demonstrated with other recombinant proteins .

  • Host strain optimization: Select E. coli strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3), which can better accommodate potentially toxic membrane proteins.

  • Expression conditions: Optimize temperature (typically lower temperatures of 16-25°C), inducer concentration, and expression duration to balance protein yield with proper folding.

  • Fusion tags: Consider solubility-enhancing tags (MBP, SUMO) or affinity tags (His, GST) positioned at either the N or C-terminus, ensuring they don't interfere with the SPOR domain function.

  • Secretion enhancement: Leverage the finding that high D,D-carboxypeptidase activity enhances extracellular recombinant protein production in E. coli. Co-expression with DacA or manipulation of cell wall peptidoglycan synthesis may increase the yield of properly folded damX protein .

Optimization ParameterRecommended ConditionsExpected Effect
Growth temperature18-25°CReduces inclusion body formation
IPTG concentration0.1-0.5 mMBalances expression level with toxicity
Expression time4-16 hoursAllows proper folding while maximizing yield
Media supplements0.5-1% glucose, 5-10 mM MgSO₄Stabilizes membrane proteins
Extraction bufferDetergent panel testingOptimizes protein solubilization

How can researchers effectively measure damX's interaction with peptidoglycan?

To effectively measure damX's interaction with peptidoglycan through its SPOR domain, researchers should employ multiple complementary approaches:

  • In vitro binding assays: Purify recombinant damX protein (or isolated SPOR domain) and assess binding to purified peptidoglycan fragments using techniques such as surface plasmon resonance (SPR), microscale thermophoresis (MST), or isothermal titration calorimetry (ITC).

  • Pull-down experiments: Use immobilized peptidoglycan fragments to capture damX from cell lysates, followed by Western blot detection.

  • Site-directed mutagenesis: Create point mutations in the SPOR domain to identify specific residues critical for peptidoglycan binding, then assess these mutants using localization studies and binding assays.

  • Competitive binding experiments: Determine binding specificity by competing labeled damX with different peptidoglycan structures or other SPOR domain-containing proteins.

  • In vivo cross-linking: Utilize photoactivatable or chemical cross-linkers to capture in vivo interactions between damX and peptidoglycan components.

The experimental design should include appropriate controls and consider the quasi-experimental approaches described by Campbell and Stanley to address potential confounding variables when direct manipulation is not possible .

How does damX contribute to bile resistance mechanisms in enteric bacteria?

To investigate damX's role in bile resistance, researchers should implement a comprehensive experimental strategy:

  • Survival assays: Compare survival rates of wild-type, damX knockout, and complemented strains in media containing varying concentrations of bile salts or individual bile components. Plot time-course survival curves and determine MIC (minimum inhibitory concentration) values.

  • Membrane integrity assessment: Utilize membrane-impermeant dyes (e.g., propidium iodide) or leakage assays to quantify membrane damage in response to bile challenge in wild-type versus damX mutant strains.

  • Membrane composition analysis: Compare phospholipid profiles, fatty acid composition, and membrane fluidity in wild-type and damX mutant strains before and after bile exposure using mass spectrometry and fluorescence anisotropy measurements.

  • Gene expression profiling: Conduct RNA-seq analysis to identify differentially expressed genes in damX mutants versus wild-type strains in response to bile stress, focusing on genes involved in membrane biogenesis and stress response pathways.

  • Protein localization studies: Examine whether damX localization changes upon bile exposure, potentially indicating a direct role in stress response mechanisms.

  • Comparative analysis: Extend studies to both E. coli and Salmonella to determine if damX's role in bile resistance involves conserved or species-specific mechanisms .

The experimental approach should integrate both within-species (E. coli) and cross-species (E. coli vs. Salmonella) comparisons, with attention to the time-series experimental design considerations outlined by Campbell and Stanley .

What methodologies can reveal the regulatory network controlling damX expression?

To elucidate the regulatory network controlling damX expression, researchers should employ these methodological approaches:

  • Promoter mapping and characterization: Identify the precise damX promoter region using 5' RACE and promoter reporter fusions. Consider engineering approaches similar to those used with the dacA promoter, including the insertion of additional SD sequences to enhance expression and understand regulatory elements .

  • Transcription factor identification:

    • Use DNA-affinity chromatography with the damX promoter region to isolate potential regulatory proteins

    • Perform ChIP-seq with antibodies against suspected transcription factors

    • Implement one-hybrid screening to identify proteins binding to the damX promoter

  • Environmental regulation studies: Systematically examine damX expression under various conditions (pH, temperature, nutrient availability, bile presence) using qRT-PCR and reporter fusions to identify environmental triggers for expression changes.

  • Global regulator knockout panel: Assess damX expression in strains lacking global regulators (e.g., CRP, H-NS, FIS) to identify regulatory dependencies.

  • Network analysis: Integrate expression data into regulatory network models, using statistical approaches to distinguish direct versus indirect effects on damX expression.

  • Single-cell analysis: Implement microfluidics-based approaches to examine cell-to-cell variability in damX expression, potentially revealing stochastic aspects of its regulation.

How can researchers differentiate between the direct and indirect effects of damX mutations?

Differentiating between direct and indirect effects of damX mutations requires a systematic approach to control for confounding variables:

  • Complementation studies: Create genetic complementation constructs expressing wild-type damX under control of an inducible promoter in damX knockout backgrounds. Titrate expression levels to determine if phenotypes are rescued in a dose-dependent manner.

  • Specific domain mutations: Generate point mutations in specific functional domains (e.g., SPOR domain) rather than complete gene deletions to isolate domain-specific effects.

  • Temporal control experiments: Use rapidly inducible or repressible systems to modulate damX expression, allowing observation of immediate versus delayed effects on cellular phenotypes.

  • Suppressor mutant screening: Identify secondary mutations that suppress damX mutant phenotypes, providing insight into functional pathways.

  • Proteomics comparison: Implement temporal comparative proteomics to identify the earliest protein-level changes following damX mutation or depletion.

  • Metabolic flux analysis: Track metabolic pathways to identify biochemical processes affected by damX mutation.

This approach combines elements of the true experimental design with regression-discontinuity analysis described by Campbell and Stanley to establish causality in complex biological systems .

What statistical approaches are recommended for analyzing damX localization patterns?

When analyzing damX localization patterns, researchers should employ these statistical methodologies:

  • Quantitative image analysis:

    • Implement automated cell segmentation and protein localization quantification

    • Measure fluorescence intensity profiles along the cell length

    • Calculate protein concentration at different cellular compartments (septal region vs. lateral membrane)

    • Determine colocalization coefficients with other divisome proteins using Pearson's or Manders' coefficients

  • Statistical testing framework:

    • Use appropriate parametric (ANOVA, t-test) or non-parametric tests (Mann-Whitney U, Kruskal-Wallis) based on data distribution

    • Implement mixed-effects models to account for batch effects and cellular heterogeneity

    • Apply multiple testing corrections (Bonferroni, Benjamini-Hochberg) when analyzing multiple conditions

  • Temporal dynamics analysis:

    • Employ time-series analysis methods similar to those described by Campbell and Stanley

    • Apply autocorrelation functions to identify periodic localization patterns

    • Implement Markov models to capture state transitions in protein localization during cell cycle progression

  • Population heterogeneity assessment:

    • Analyze cell-to-cell variability using distribution-based metrics rather than simple means

    • Apply clustering algorithms to identify subpopulations with distinct localization patterns

    • Quantify the frequency of different localization patterns across growth conditions

How should researchers interpret contradictory results in damX functional studies?

When faced with contradictory results in damX functional studies, researchers should implement this systematic approach to interpretation:

  • Strain background analysis: Compare the genetic backgrounds used in different studies, as strain-specific genetic differences may influence damX function. Create a comprehensive table documenting strain genotypes, including known mutations.

  • Environmental condition comparison: Analyze experimental conditions (media composition, growth phase, temperature) that may explain divergent results. Standardize conditions where possible or systematically test condition-dependent effects.

  • Methodological evaluation: Critically assess differences in methodological approaches, considering sensitivity, specificity, and limitation of each method. Implement multiple methodological approaches to validate key findings.

  • Statistical power assessment: Calculate statistical power in existing studies to determine if sample sizes were adequate. Consider meta-analysis approaches to integrate data across studies when appropriate.

  • Molecular interpretation framework: Develop hypotheses that could reconcile seemingly contradictory results, such as:

    • Context-dependent functions of damX in different cellular pathways

    • Compensatory mechanisms that mask phenotypes under certain conditions

    • Differential interactions with other cellular components

  • Experimental design to resolve contradictions: Design definitive experiments specifically addressing contradictions, using the counterbalanced designs or the multiple time-series design approach described by Campbell and Stanley .

What emerging technologies could advance understanding of damX function?

Several cutting-edge technologies hold promise for deeper insights into damX function:

  • Cryo-electron tomography: This technique can visualize the native structure and localization of damX within the bacterial membrane at nanometer resolution, revealing its interaction with the peptidoglycan layer and other divisome components in situ.

  • Super-resolution microscopy approaches: Techniques such as PALM, STORM, or STED microscopy can overcome the diffraction limit to provide precise localization data on damX throughout the cell cycle with nanometer precision.

  • Proximity labeling proteomics: Methods like BioID or APEX2 can identify proteins in close proximity to damX in living cells, helping map the protein interaction network around damX with temporal resolution.

  • Single-molecule tracking: Tracking individual damX molecules in living cells can reveal dynamic behaviors and interaction kinetics with other cellular components.

  • CRISPR interference/activation systems: CRISPRi/CRISPRa approaches allow for precise modulation of damX expression levels to study dose-dependent effects and regulatory networks.

  • Microfluidics-based approaches: These enable the study of damX function under precisely controlled environmental conditions with single-cell resolution, particularly useful for examining heterogeneity in bacterial populations.

  • Quantitative metabolomics: These approaches can identify metabolic changes resulting from damX perturbation, potentially revealing unexpected roles in cellular metabolism.

How can damX research inform broader understanding of bacterial cell division?

Research on damX can contribute to the broader understanding of bacterial cell division through these research directions:

  • Comparative analysis across bacterial species: Extend damX functional studies across diverse bacterial species to determine conserved and divergent aspects of its role in cell division. This approach could reveal fundamental principles of bacterial divisome assembly.

  • Integration with mathematical models of bacterial division: Incorporate damX localization and activity data into quantitative models of the bacterial division process, allowing for predictive simulations of division dynamics under various conditions.

  • Exploration of damX as an antibiotic target: Investigate whether targeting damX could provide a novel approach for antibiotic development, particularly for enteric pathogens requiring bile resistance for colonization.

  • Investigation of damX regulation during host infection: Examine damX expression and function during in vivo infection models to understand its potential role in bacterial adaptation to host environments.

  • Analysis of damX evolution: Study the evolutionary conservation and diversification of damX across bacterial lineages to understand selective pressures on this divisome component.

  • Connection to stress response pathways: Explore how damX function intersects with bacterial stress response systems, potentially revealing integrated mechanisms for coordinating division with environmental adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.