Recombinant Escherichia coli Protein Ddg (lpxP)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Escherichia coli Protein Ddg, also known as LpxP, is an acyltransferase enzyme expressed in Escherichia coli . Specifically, LpxP incorporates a palmitoleoyl moiety into nascent lipid A in place of the secondary laurate chain normally added by LpxL(HtrB) . The protein is produced using recombinant DNA technology, where the gene encoding LpxP is inserted into E. coli to facilitate its expression and production .

Role in Cold Adaptation

LpxP is induced by cold shock in E. coli . At low growth temperatures, LpxP incorporates palmitoleate into lipid A molecules . The presence of palmitoleate in lipid A influences the properties of the outer membrane . A mutant lacking LpxP (MKV11) showed a tenfold increase in sensitivity to rifampicin and vancomycin at 12°C compared to wild-type cells, suggesting that palmitoleoyltransferase may confer a selective advantage upon E. coli cells growing at lower temperatures by making the outer membrane a more effective barrier to harmful chemicals .

Applications in Biotechnology

  • Lithium Adsorption: Recombinant E. coli can be engineered to selectively adsorb and recover lithium from the environment by employing a bacterial cell surface display strategy . For example, lithium-binding peptides can be integrated into membrane proteins like OmpC to enhance lithium adsorption .

  • Protein Production: E. coli is a widely used host for recombinant protein expression due to its rapid growth, well-understood genetics, and ease of genetic manipulation . Various expression systems, such as the T7 promoter system and lambda phage-based systems, are employed for high-level production of heterologous proteins .

Data Table: Properties of Recombinant Escherichia coli Protein Ddg (LpxP)

PropertyDescription
Product CodeCSB-CF364866ENV
StorageStore at -20°C; for extended storage, conserve at -20°C or -80°C .
Uniprot No.P0ACV2
Product TypeTransmembrane Protein
Immunogen SpeciesEscherichia coli (strain K12)
Sourcein vitro E.coli expression system
Target NameslpxP
Protein NamesProtein Ddg
Expression Region1-306
Tag InfoN-terminal 10xHis-tagged
Protein LengthFull length protein
FunctionCatalyzes the transfer of palmitoleate from palmitoleoyl-ACP to Kdo(2)-lipid IV(A) to form Kdo(2)-[palmitoleoyl] lipid IV(A)
Key FeatureIncorporates a palmitoleoyl moiety into nascent lipid A in place of the secondary laurate chain, particularly under cold shock conditions, influencing outer membrane properties and antibiotic resistance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
lpxP; ddg; b2378; JW2375; Lipid A biosynthesis palmitoleoyltransferase; Kdo(2-lipid IV(A palmitoleoyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
lpxP
Target Protein Sequence
MFPQCKFSREFLHPRYWLTWFGLGVLWLWVQLPYPVLCFLGTRIGAMARPFLKRRESIAR KNLELCFPQHSAEEREKMIAENFRSLGMALVETGMAWFWPDSRVRKWFDVEGLDNLKRAQ MQNRGVMVVGVHFMSLELGGRVMGLCQPMMATYRPHNNQLMEWVQTRGRMRSNKAMIGRN NLRGIVGALKKGEAVWFAPDQDYGRKGSSFAPFFAVENVATTNGTYVLSRLSGAAMLTVT MVRKADYSGYRLFITPEMEGYPTDENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKTRPVG ESSLYI
Uniprot No.

Target Background

Function

This recombinant Escherichia coli protein Ddg (lpxP) catalyzes the transfer of palmitoleate from palmitoleoyl-acyl carrier protein (ACP) to Kdo(2)-lipid IV(A), forming Kdo(2)-(palmitoleoyl)-lipid IV(A). It's crucial for the biosynthesis of a specific lipid A molecular species found only in cells grown at low temperatures. This enzyme may provide a selective advantage at lower temperatures by enhancing the outer membrane's barrier function against harmful substances.

Database Links
Protein Families
LpxL/LpxM/LpxP family, LpxP subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.