Recombinant Escherichia coli Protein elaB (elaB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli Protein elaB

Recombinant elaB is a C-tail-anchored inner membrane protein produced via genetic engineering in E. coli. Native elaB (accession: G7173, UniProt: P0AEH5) is a 101-amino-acid protein with a conserved C-terminal transmembrane domain (Fig. 1) . It plays critical roles in stress responses and persister cell regulation, distinguishing it from other stress-related toxins like TisB and GhoT .

Oxidative Stress Resistance

ElaB protects E. coli against reactive oxygen species (ROS), though its mechanism differs from toxin-based stress responses . Deletion of elaB reduces survival under oxidative stress .

Heat Shock Tolerance

ElaB enhances thermal resistance by maintaining membrane integrity during heat stress. Unlike TisB/GhoT, it does not induce cell death .

Persister Cell Regulation

ConditionEffect of elaB Deletion
Antibiotic StressIncreased persister formation (e.g., ciprofloxacin tolerance)
Stress AdaptationReduced resilience to oxidative/heat stress

Transcriptional Regulation by RpoS

ElaB expression is tightly regulated by the stationary-phase sigma factor RpoS (σ³⁸) . Key findings:

Regulatory MechanismEvidence
RpoS Binding SitePromoter region containing TTCAGG (−35) and TCTATAGTTA (−10) motifs
Induction TriggersStationary phase, nutrient deprivation (e.g., M9 minimal medium)
Regulatory Impact13.9-fold upregulation in stationary phase; absent in rpoS mutants

Key Studies

StudyMethodsFindings
Guo et al. (2017) EMSA, lacZ reporter assays, growth curvesRpoS binds elaB promoter; deletion increases persister cells by 2–3-fold
Wood et al. (2017) Stress assays, membrane fractionationElaB localizes to inner membrane; protects against H₂O₂/heat

Comparative Analysis

ProteinFunctionPersister Impact
TisBToxin-induced dormancyIncreases persistence
GhoTMembrane-disrupting toxinIncreases persistence
ElaBStress protection, membrane stabilityReduces persistence

Biotechnological and Medical Implications

While direct applications of recombinant elaB are not yet documented, its roles suggest potential uses:

  1. Antibiotic Synergy: Targeting elaB to reduce persister populations in infections.

  2. Industrial Strain Engineering: Enhancing stress tolerance in biofuel-producing E. coli.

  3. Biomarker Discovery: Tracking persistent infections via elaB expression profiling.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
elaB; yfbD; b2266; JW2261; Protein ElaB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
elaB
Target Protein Sequence
MSNQFGDTRIDDDLTLLSETLEEVLRSSGDPADQKYVELKARAEKALDDVKKRVSQASDS YYYRAKQAVYRADDYVHEKPWQGIGVGAAVGLVLGLLLARR
Uniprot No.

Target Background

Gene References Into Functions
  1. A study characterized the function of the C-tail-anchored inner membrane protein ElaB in *E. coli*. ElaB enhances resistance to oxidative and heat stress, while its inactivation increases persister cell formation. PMID: 28242719
Database Links
Protein Families
ElaB/YgaM/YqjD family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the basic structure of ElaB protein?

ElaB is a small protein consisting of 101 amino acids with a single transmembrane domain located at the C-terminus. This C-terminal transmembrane domain is highly conserved across several bacterial species, while the N-terminal region shows less conservation in terms of length and amino acid composition. The transmembrane domain is positioned very close to the end of the C-terminus and is followed by two to four residues containing one to three arginines .

Methodology for structural characterization:

  • Fusion of fluorescent proteins (mCherry or GFP) to the C-terminus of ElaB for visualization

  • Membrane fractionation coupled with Western blotting for localization studies

  • Comparison with other C-tail-anchored proteins (YqjD and YgaM) that share similar transmembrane domains

How is ElaB localized within E. coli cells?

ElaB is primarily localized to the inner membrane of E. coli with particular concentration at the cell poles. This has been confirmed through multiple experimental approaches:

  • Chromosomal fusion of mCherry to the C-terminus of the elaB gene shows polar localization

  • Cell fractionation studies demonstrate that ElaB is present exclusively in the inner membrane fraction and not in the outer membrane fraction

  • Control experiments with known inner membrane protein MacB and outer membrane protein OmpA confirm the specificity of this localization

How is elaB gene expression regulated in E. coli?

The expression of elaB is primarily regulated by the stationary-phase sigma factor RpoS (σ38) through direct binding to the elaB promoter:

  • Transcription of elaB is significantly upregulated (13.9 ± 0.2-fold) when cells enter stationary phase

  • Expression is also increased (9.5 ± 0.6-fold) when cells grow in nutrient-limited minimal medium compared to rich medium during exponential growth

  • In an rpoS deletion mutant, there is no induction of elaB in the stationary phase

  • Overexpression of rpoS increases elaB transcription 2.4 ± 0.1-fold during exponential growth in minimal medium

What methods can be used to study RpoS regulation of elaB?

Several complementary approaches have been used to demonstrate direct regulation of elaB by RpoS:

  • Electrophoretic Mobility Shift Assay (EMSA): Purified RpoS in the presence of E. coli core RNA polymerase binds specifically to DNA fragments containing the RpoS binding site close to the elaB start codon (probe 2) in a dose-dependent manner

  • Promoter Activity Assays: Using lacZ reporter constructs, wild-type cells show significantly higher β-galactosidase activity (1,034.2 ± 34.2 Miller units) than ΔrpoS cells (268.9 ± 15.9 Miller units)

  • Site-Directed Mutagenesis: Altering the conserved RpoS binding site from TTCAGG (−35 region)...TCTATAGTTA (−10 region) to AAAAAA (−35 region)...CCCCCCCCCC (−10 region) abolishes RpoS regulation

  • Complementation Experiments: Overexpression of rpoS in ΔrpoS cells restores promoter activity when using wild-type promoter constructs but not with mutated binding sites

What stress conditions does ElaB protect against?

ElaB plays a significant role in protecting E. coli cells against multiple stress conditions:

  • Heat Shock: Deletion of elaB reduces survival at 65°C for 10 minutes by approximately 3.3 × 10^5-fold compared to wild-type cells

  • Oxidative Stress: When treated with 20 mM H₂O₂ for 10 minutes, cell survival is reduced approximately 3.6 × 10^4-fold in elaB deletion mutants

  • Complementation: Reintroduction of the elaB gene restores stress resistance to levels similar to wild-type in both conditions

How does ElaB affect antibiotic tolerance and persister cell formation?

Interestingly, ElaB decreases persister cell formation in E. coli:

What expression systems are effective for producing recombinant ElaB?

Based on general principles for membrane protein expression in E. coli, the following strategies are recommended for ElaB:

  • Expression Vector Selection: Vectors with inducible promoters (T7, tac) and appropriate affinity tags (His, MBP) for membrane proteins

  • E. coli Host Strains: Specialized strains for membrane protein expression such as C41(DE3), C43(DE3), or Lemo21(DE3)

  • Fusion Strategies: Previous successful approaches include:

    • C-terminal mCherry fusion for visualization without affecting localization

    • C-terminal GFP fusion for localization studies

    • N-terminal His-tag for purification and detection

What are the challenges specific to expressing recombinant tail-anchored membrane proteins like ElaB?

Tail-anchored membrane proteins present unique expression challenges:

  • Membrane Insertion: C-tail-anchored proteins like ElaB lack N-terminal signal sequences, requiring specific machinery for proper membrane targeting

  • Potential Toxicity: While ElaB itself does not appear to be toxic when overexpressed (unlike YqjD) , expression conditions should be carefully optimized

  • Solubilization Challenges: The transmembrane domain requires appropriate detergents for extraction from membranes while maintaining structure and function

  • Verification of Proper Folding: Functional assays are needed to confirm that recombinant ElaB retains its native activity in stress protection

How can researchers use ElaB to study bacterial stress response mechanisms?

ElaB provides a unique model system for studying stress response mechanisms:

  • Comparative Analysis: Compare elaB with paralogs YgaM and YqjD to understand functional divergence among C-tail-anchored membrane proteins

  • Regulatory Networks: Study the integration of RpoS-dependent regulation with other stress response pathways

  • Structure-Function Relationships: Investigate how the conserved transmembrane domain contributes to stress protection

  • Membrane Dynamics: Explore how ElaB's polar localization relates to its function in stress resistance

What methodological approaches can be used to study ElaB's role in persister cell formation?

To investigate ElaB's role in reducing persister formation, researchers can employ:

  • Time-Kill Assays: Monitor survival dynamics during antibiotic treatment with multiple antibiotic classes at >10× MIC concentrations

  • Single-Cell Analysis: Use microfluidics combined with time-lapse microscopy to observe persister formation at the single-cell level

  • Transcriptional Profiling: Compare gene expression patterns between wild-type and ΔelaB strains during antibiotic exposure

  • Metabolic Studies: Investigate whether ElaB affects energy metabolism pathways known to be involved in persister formation

  • Membrane Integrity Assays: Assess whether ElaB influences membrane permeability or potential, which might affect antibiotic uptake or activity

What are effective protocols for measuring ElaB's protective effects against oxidative and heat stress?

Protocol for Heat Stress Resistance Assay:

  • Grow wild-type, ΔelaB, and complemented strains to the desired growth phase (typically stationary phase)

  • Expose cultures to 65°C for precisely 10 minutes

  • Perform serial dilutions and plate for viable count determination

  • Calculate survival rates compared to pre-treatment controls

Protocol for Oxidative Stress Resistance Assay:

  • Grow cultures to appropriate phase

  • Treat with 20 mM H₂O₂ for 10 minutes

  • Neutralize remaining H₂O₂ with catalase

  • Determine viable counts and calculate survival rates

What troubleshooting approaches can address challenges in studying ElaB?

Common challenges when working with ElaB include:

  • Detection Issues: Low natural expression levels may require sensitive detection methods. Use epitope tags and optimize Western blot conditions specifically for membrane proteins

  • Localization Artifacts: Overexpression may cause mislocalization. Validate with chromosomal fusions at physiological expression levels

  • Purification Difficulties: Optimize detergent selection for solubilization through systematic screening

  • Functional Assessment: Develop high-throughput assays for stress protection to facilitate mutational analysis of structure-function relationships

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.