Recombinant Escherichia coli Protein-export membrane protein SecG (secG)

Shipped with Ice Packs
In Stock

Description

Role in Protein Export and Signal Sequence Recognition

SecG modulates the efficiency of the Sec translocon, particularly when signal sequences are mutated or inefficient.

Mechanisms

  • Topology Inversion: SecG undergoes cycles of membrane inversion, aiding SecA’s ATP-dependent translocation .

  • Signal Sequence Suppression: prlH mutations (e.g., prlH alleles) restore export for defective signal peptides (e.g., malE16, rbsB16) by enhancing SecYEG activity .

  • Residual Export: In secG deletion strains, residual export of proteins with mutant signal sequences is severely impaired .

Example: Suppression of malE16
A mutant maltose-binding protein (malE16) with a Thr16→Lys substitution shows reduced export. In secG null strains, export is further diminished, but prlH mutations restore activity .

Genetic and Phenotypic Studies

SecG’s impact varies by strain and experimental context.

Key Findings

Study FocusResultsImplicationsSource
Cold SensitivityΔsecG strains show cold sensitivity only when combined with glpR mutationPhospholipid imbalance exacerbates SecG dependence
Phospholipid MetabolismglpR mutation depletes glycerol-3-phosphate, impairing membrane stabilitySecG stabilizes SecYEG under lipid stress
Signal Sequence DependenceWild-type signals show minimal SecG dependence; mutant signals rely heavily on SecGSecG compensates for signal peptide defects

Interactions with Other Proteins and Systems

SecG integrates with the broader Sec translocon and auxiliary systems.

Interaction Partners

PartnerRole in ExportSource
SecYEGForms the core channel; SecG stabilizes SecYEG conformation
SecASecG enhances SecA’s membrane insertion-deinsertion cycle
YidCSecG indirectly supports membrane protein insertion via YidC
Tat PathwaySecG may coordinate with Tat for folded protein export

Research Implications and Future Directions

SecG’s auxiliary role highlights its importance in stress adaptation and export optimization.

Critical Insights

  • Therapeutic Targets: SecG homologs in pathogens (e.g., Staphylococcus aureus) could be targets for antimicrobial agents .

  • Biotechnology: Engineering prlH alleles may improve recombinant protein secretion in E. coli .

  • Evolutionary Conservation: SecG homologs in eukaryotes (e.g., Sec61β) suggest conserved roles in translocon dynamics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please specify them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
secG; b3175; JW3142; Protein-export membrane protein SecG; P12; Preprotein translocase band 1 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
secG
Target Protein Sequence
MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTSDIPN
Uniprot No.

Target Background

Function
SecG is a subunit of the SecYEG protein translocation channel. Overexpression of certain hybrid proteins has been linked to disruption of the protein secretion apparatus, potentially leading to cell death. While this may be true, it also results in FtsH-mediated degradation of SecY. Treatment with antibiotics that inhibit translation elongation, such as chloramphenicol, also leads to degradation of SecY and SecE, but not SecG.
Gene References Into Functions
  1. Research indicates that SecG plays a crucial role in residual export mediated by mutant signal sequences, and the SecYE dimer is often only detectable in the presence of SecG. PMID: 25404704
  2. The hydrophobicity threshold for SecYEG-mediated cell membrane insertion is considerably lower than that for Sec61-mediated insertion. PMID: 23659793
  3. Studies demonstrate that ribosome binding is sufficient to open the SecYEG channel. PMID: 23645666
  4. Data suggest that SecG inversion occurs only when MPIase associates with SecYEG. PMID: 23716687
  5. Analysis of charge composition features in model single-span membrane proteins has revealed factors that determine the selection of YidC and SecYEG translocase pathways in Escherichia coli. PMID: 23355473
  6. Research has focused on the conformational dynamics of the plug domain of the SecYEG protein-conducting channel. PMID: 22033919
  7. SecYEG-bound SecA undergoes ATP-dependent conformational changes that are not observed for soluble SecA. PMID: 15850376
  8. Cryo-electron microscopy reconstruction of the E. coli protein-conducting channel, SecYEG, complexed with the ribosome and a nascent chain containing a signal anchor has been performed. PMID: 16292303
  9. Cotranslational targeting of a protein to the E. coli SecYEG complex does not guarantee its export. Export also depends on subsequent events involving sequences both within and just beyond the signal peptide. PMID: 19211555

Show More

Hide All

Database Links
Protein Families
SecG family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of SecG in the Sec-dependent protein export pathway?

SecG is an auxiliary protein in the Sec-dependent protein export pathway of Escherichia coli that enhances translocation efficiency. Although not essential for viability, SecG stimulates translocation activity by modulating the membrane insertion-deinsertion cycle of SecA, the ATP-dependent motor protein that drives protein translocation . The core translocase consists of the integral membrane proteins SecY and SecE, which form the protein-conducting channel, and the peripheral membrane protein SecA. SecG associates with the SecYE complex to enhance translocation activity beyond what is possible with the core components alone .

How does SecG interact with other components of the Sec translocon?

SecG interacts primarily with the SecYE complex, copurifying with these components during isolation procedures . Functionally, SecG and the SecDFYajC complex have overlapping roles in activating the translocation process, though they operate through slightly different mechanisms. While SecG stimulates the insertion of SecA after initiation of translocation, SecDFYajC increases SecA insertion and stabilizes the inserted state . These complementary functions optimize the efficiency of the protein export machinery, providing robustness to the system even though neither SecG nor SecDFYajC is absolutely required for translocation activity .

Why do researchers observe strain-dependent phenotypes when studying SecG deletion mutants?

The phenotypic variation observed in SecG deletion mutants results from genetic interactions with other cellular components. Initially, secG deletion appeared to cause severe export defects and cold sensitivity, but subsequent studies revealed these phenotypes were strain-dependent . Research has demonstrated that the cold-sensitive phenotype requires both the secG deletion and a mutation in glpR that causes constitutive expression of the glp regulon . This glpR mutation leads to intracellular depletion of glycerol-3-phosphate due to constitutive synthesis of GlpD, limiting phospholipid biosynthesis and creating an imbalance in membrane phospholipids . Understanding these strain dependencies is crucial for accurate interpretation of experimental results when working with SecG mutants.

How does phospholipid composition influence SecG dependency in protein translocation?

The relationship between phospholipid composition and SecG function represents a sophisticated interplay between membrane characteristics and protein translocation efficiency. Research indicates that deletion of secG creates a conditional dependency on optimal phospholipid balance . The cold-sensitive phenotype observed in secG deletion strains containing a glpR mutation can be ameliorated by supplementing growth medium with glycerol-3-phosphate or by introducing a glpD mutation .

Several high-copy suppressors of this cold sensitivity include B. subtilis pgsA and scgR genes, as well as E. coli pgsA and gpsA genes, all of which influence phospholipid biosynthesis . This suggests that increased levels of acidic phospholipids can compensate for SecG absence. For researchers investigating SecG function, these findings indicate that experimental designs should carefully control for phospholipid composition, potentially through defined media supplementation or genetic backgrounds with characterized phospholipid profiles.

What methodological approaches are most effective for studying SecG topology inversions during protein translocation?

Studying SecG topology inversions during protein translocation requires sophisticated biophysical and biochemical techniques. Researchers should consider the following methodological approach:

  • Site-directed cysteine mutagenesis: Introduce cysteine residues at strategic positions within SecG to serve as reporters for topological changes.

  • Chemical modification assays: Use membrane-impermeable thiol-reactive reagents to detect exposure of specific SecG domains during the translocation cycle.

  • Cross-linking studies: Employ bifunctional cross-linkers to capture transient interactions between SecG and other translocon components during the insertion-deinsertion cycle.

  • Real-time fluorescence techniques: Incorporate environmentally sensitive fluorophores at specific positions to monitor conformational changes during SecA cycling.

  • Cryo-electron microscopy: Visualize the SecYEG complex at different stages of the translocation process using rapid freezing techniques.

These methodologies must be performed under carefully controlled conditions that maintain translocation competence, particularly when examining cold-sensitive phenotypes that may require specific temperature management protocols .

How can researchers distinguish between direct effects of SecG absence versus secondary effects mediated by phospholipid imbalance?

Distinguishing between direct effects of SecG absence and secondary effects from phospholipid imbalance requires a multi-faceted experimental approach:

Experimental StrategyPurposeImplementation
Genetic complementationDetermine if phenotypes are directly caused by SecG absenceReintroduce wild-type secG on plasmids with varying expression levels
Phospholipid supplementationAssess if phospholipid balance restores functionAdd specific phospholipids or precursors to growth media
Liposome reconstitutionExamine translocation in defined lipid environmentsReconstitute purified Sec components in liposomes with controlled lipid composition
Suppressor mutation analysisIdentify genetic factors that influence SecG dependencyScreen for mutations that suppress secG deletion phenotypes
Temperature-shift experimentsSeparate cold-sensitive from general translocation defectsPerform assays at various temperatures with appropriate controls

Researchers should implement these strategies in parallel, using isogenic strains that differ only in secG status to minimize confounding variables. The glpR status should be explicitly determined in all strains using molecular genetic methods to account for its significant influence on the observed phenotypes .

What expression systems are optimal for producing recombinant SecG for functional studies?

Designing effective expression systems for SecG requires balancing protein production with proper membrane integration. For optimal results, researchers should consider:

  • Promoter selection: The rhamnose promoter in a rha operon deletion strain background has shown promise for tunable expression of membrane proteins, allowing calibration of production levels to match the capacity of the secretory apparatus .

  • Signal peptide optimization: Testing multiple signal peptides is crucial, as different secretory proteins may require specific signals for efficient translocation. The STII signal peptide with modified translational initiation regions (TIRs) has been successful for periplasmic protein production .

  • Translational tuning: Rather than maximizing expression, optimizing translational levels through TIR modifications can significantly enhance proper SecG integration. Research indicates a narrow translational range is required for optimal membrane protein production .

  • Vector copy number: Low to medium copy number vectors are preferable, as high copy numbers can saturate the secretory apparatus and lead to cytoplasmic accumulation of precursor material .

  • Induction protocol: Gradual induction protocols allow the cell to adapt its secretory capacity, potentially upregulating complementary components like SecA, LepB, and YidC .

This approach recognizes that E. coli can adapt its protein secretory apparatus for enhanced recombinant protein production when expression is carefully calibrated .

What are the most reliable methods for assessing SecG topology and conformational changes during the translocation cycle?

Reliable assessment of SecG topology and conformational changes requires a combination of techniques that can capture the dynamic nature of the translocation process:

  • Cysteine accessibility methods: Strategic placement of cysteine residues throughout SecG structure allows mapping of membrane-exposed regions using membrane-impermeable thiol-reactive reagents.

  • Disulfide cross-linking: Engineered cysteine pairs can form disulfide bonds when in proximity, providing information about SecG's three-dimensional structure and conformational changes.

  • Protease protection assays: Limited proteolysis combined with antibody detection or mass spectrometry can identify protease-accessible regions in different translocation states.

  • FRET-based approaches: Fluorescence resonance energy transfer between donor-acceptor pairs strategically placed within SecG or between SecG and other translocon components can detect real-time conformational changes.

  • Hydrogen-deuterium exchange mass spectrometry: This technique can identify regions of SecG that undergo structural rearrangements during the translocation cycle by measuring differential solvent accessibility.

These methodologies should be combined with genetic approaches that lock SecG in specific conformational states to capture transient intermediates in the translocation process .

How should researchers address potential artifacts when studying SecG-dependent translocation in vitro?

In vitro reconstitution of Sec-dependent translocation presents several potential artifacts that researchers must address methodically:

  • Membrane composition control: Since phospholipid composition significantly affects SecG function, researchers must carefully define membrane lipid composition in reconstituted systems. Compare results using total E. coli lipid extracts versus defined synthetic lipid mixtures to identify lipid-dependent effects .

  • Temperature considerations: Given the cold-sensitive phenotypes associated with SecG deficiency, in vitro translocation assays should be conducted at multiple temperatures (37°C, 30°C, and 20°C) to capture temperature-dependent effects .

  • Energy source quality: ATP regeneration systems should be included to maintain consistent energy levels throughout the assay, as SecA function is highly ATP-dependent.

  • Protein substrate selection: Use multiple protein substrates with different translocation requirements, as SecG dependency varies based on substrate characteristics.

  • Component stoichiometry: Carefully control the ratio of SecYEG to SecA and other accessory factors, as non-physiological ratios may mask or exaggerate SecG effects.

  • Detergent effects: When purifying components, evaluate multiple detergents for solubilization, as detergent choice can affect protein conformation and activity.

Validation through parallel in vivo translocation assays using pulse-chase experiments will help confirm that in vitro observations reflect physiological processes.

How does SecG overexpression affect recombinant protein secretion efficiency in E. coli?

SecG overexpression affects recombinant protein secretion through complex interactions with the translocation machinery. While SecG is not essential, it optimizes translocation efficiency by enhancing the SecA cycle of membrane insertion and deinsertion . When overexpressing SecG for improved recombinant protein secretion, researchers should consider:

  • Co-expression balance: SecG overexpression should be balanced with other Sec components to maintain proper stoichiometry. Isolated overexpression of SecG without corresponding increases in SecY and SecE may not yield proportional benefits.

  • Substrate-specific effects: SecG enhancement of translocation varies with different secretory proteins. Proteins with complex folding requirements or challenging signal sequences may benefit more significantly from SecG overexpression.

  • Adaptation responses: E. coli can adapt its secretory apparatus in response to secretion stress, potentially upregulating complementary components like SecA, LepB, and YidC when SecG levels are increased .

  • Phospholipid homeostasis: SecG function is intimately connected to phospholipid composition. Overexpression strategies should consider potential impacts on membrane phospholipid balance, particularly under different growth conditions .

For optimal results, researchers should implement tunable expression systems that allow calibration of SecG levels according to the specific recombinant protein and strain background being utilized.

What genetic backgrounds are most suitable for studying SecG function in recombinant protein production?

Selecting appropriate genetic backgrounds is critical for accurate assessment of SecG function in recombinant protein production. Researchers should consider:

  • glpR status: Given the significant interaction between secG deletion and glpR mutation, all strains should be characterized for glpR status . Wild-type glpR backgrounds provide cleaner assessment of direct SecG effects.

  • Secretion stress response capacity: Strains with robust stress response systems may better accommodate perturbations in translocation efficiency. Consider using strains with characterized σE and Cpx pathway functionality.

  • Proteolytic capacity: Periplasmic and cytoplasmic protease profiles affect the stability of secreted proteins and translocation intermediates. Protease-deficient strains (e.g., lacking DegP or other specific proteases) may reveal phenotypes masked by rapid degradation in wild-type backgrounds.

  • Translational tuning capacity: Strains compatible with translational tuning through TIR modifications can help harmonize protein production rates with secretory capacity .

  • Induction system compatibility: Strains lacking endogenous regulation of induction systems (e.g., rha operon deletion strains for rhamnose-inducible systems) allow more precise control over expression levels .

Importantly, researchers should carefully document the complete genotype of strains used in SecG studies, as seemingly minor genetic differences can significantly impact experimental outcomes .

How do temperature and growth conditions modulate SecG-dependent protein translocation?

Temperature and growth conditions significantly impact SecG-dependent protein translocation through multiple mechanisms:

  • Cold sensitivity mechanism: The secG deletion combined with glpR mutation results in cold sensitivity, particularly at temperatures around 20°C . This temperature dependence likely reflects the critical role of membrane fluidity and phospholipid composition in translocon function.

  • Growth phase considerations: SecG dependency varies with growth phase, potentially due to changes in membrane composition and energy availability. Researchers should standardize sampling points across growth phases.

  • Media composition effects: Minimal versus rich media affects the expression of many translocation components. Adding glycerol-3-phosphate to growth media can ameliorate cold sensitivity in secG deletion strains with glpR mutations .

  • Oxygen availability: Aerobic versus anaerobic growth conditions alter membrane composition and energy metabolism, potentially affecting SecG function and dependency.

  • Osmotic stress influence: Changes in osmolarity affect membrane properties and may alter SecG-dependent translocation efficiency, particularly for challenging substrate proteins.

Researchers investigating SecG function should implement factorial experimental designs that systematically vary temperature and media composition to comprehensively characterize conditional phenotypes associated with SecG activity or its absence .

What structural features of SecG are essential for its role in facilitating the SecA membrane insertion-deinsertion cycle?

Understanding the structural determinants of SecG function requires detailed structure-function analysis:

  • Transmembrane domain interactions: The transmembrane segments of SecG interact with SecY to stabilize the channel configuration. Systematic mutagenesis of these interfaces can identify critical residues.

  • Topology inversion mechanism: SecG is proposed to undergo topology inversion during SecA cycling. Key residues that enable this unusual structural transition can be identified through targeted mutagenesis combined with topology mapping techniques.

  • Cytoplasmic and periplasmic loop functions: The loops connecting transmembrane segments may have specific roles in interacting with SecA or other translocation components. Truncation and substitution analysis can reveal their functional importance.

  • Lipid-interacting surfaces: Specific faces of SecG's transmembrane helices likely interact with phospholipids. Identifying these surfaces through mutagenesis and lipid-protein crosslinking would illuminate how SecG may alter local membrane properties.

  • Interaction with SecA: Mapping the SecG residues that directly contact SecA during different stages of the translocation cycle would clarify SecG's role in modulating SecA activity.

These structure-function relationships should be investigated in the context of active translocation to capture the dynamic aspects of SecG function, rather than in static structural studies alone.

How does SecG contribute to membrane protein integration versus secretory protein export?

SecG plays distinct roles in membrane protein integration versus secretory protein export, reflecting the different requirements of these processes:

  • Collaboration with YidC: SecG may influence how the Sec-translocon collaborates with YidC during membrane protein integration. This collaboration affects how transmembrane segments exit the lateral gate of SecY .

  • Lateral gate stabilization: SecG might contribute to stabilizing specific conformations of SecY's lateral gate, which is critical for the release of transmembrane segments into the lipid bilayer.

  • SecA cycling modulation: The effect of SecG on SecA cycling may differ when translocating a secretory protein versus integrating a membrane protein, due to the different mechanical requirements of these processes.

  • Substrate-specific effects: The dependency on SecG likely varies with the physicochemical properties of the translocated protein. Highly charged periplasmic domains or challenging transmembrane segments may show greater SecG dependency.

  • Phospholipid interaction during integration: SecG-dependent phospholipid organization may facilitate the integration of transmembrane segments into the lipid bilayer through local alterations in membrane properties.

Investigating these differential effects requires careful experimental design using model substrates that represent both secretory proteins and membrane proteins with varying degrees of complexity.

What is the molecular basis for the observed genetic interactions between secG deletion and glpR mutation?

The molecular basis for the genetic interaction between secG deletion and glpR mutation involves a complex interplay between protein translocation and membrane phospholipid composition:

Researchers can test these molecular interactions through lipidomic analysis of membrane composition in various genetic backgrounds, combined with in vitro reconstitution studies using defined lipid compositions to determine the specific lipid requirements for optimal SecG-dependent and SecG-independent translocation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.