Recombinant Escherichia coli Protein gltF (gltF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gltF; b3214; JW3181; Protein GltF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-254
Protein Length
Full Length of Mature Protein
Species
Escherichia coli (strain K12)
Target Names
gltF
Target Protein Sequence
TDSTDTELTIIGEYTPGACTPVVTGGGIVDYGKHHNSALNPTGKSNKLVQLGRKNSTLNI TCTAPTLIAVTSKDNRQSTIVALNDTSYIEKAYDTLVDMKGTKNAFGLGSAPNGQKIGAA SIGIDRSNGGIHAADDTGEIPVDLIQTDHWSAATPTWKASSNGAFCSLTSCSAIERGYSV AKTGELTPVAITAVTFPLLIDAAVNDNTILGSDETIKLDGNVTISVQYL
Uniprot No.

Target Background

Function

Involved in the induction of nitrogen regulatory (NTR) enzymes in response to nitrogen deprivation, and in glutamate biosynthesis. It may also mediate the glutamate-dependent repression of the glt operon.

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is gltF and how is it organized in the E. coli genome?

gltF is part of the gltBDF operon of Escherichia coli, which comprises the structural genes for the large (gltB) and small (gltD) subunits of glutamate synthase and a third gene, gltF. The operon is located at 69 min of the E. coli linkage map as determined through complementation analysis. Northern blot hybridization experiments have confirmed the presence of a major tricistronic mRNA molecule when probed with DNA containing single genes of the operon .

The genetic organization reveals that gltF is downstream of gltB and gltD, with an A/T-rich region between gltD and gltF that contains a weak promoter and a translation initiation site for gltF . This organization suggests that while gltF is part of the operon, it may also be independently regulated under certain conditions.

What are the structural characteristics of the gltF protein?

The gltF protein has been identified as a 30,200-dalton polypeptide . Sequence analysis has revealed that the GltF protein contains a signal peptide, which is cleaved off during export into the periplasmic space . This periplasmic localization suggests that gltF's function may be associated with extracytoplasmic processes rather than intracellular metabolic regulation as initially thought.

The protein's complete structural characterization, including crystallographic studies, has not been extensively reported in the literature, presenting an opportunity for further research in this area.

What expression systems are recommended for recombinant production of gltF?

For recombinant production of gltF in E. coli, several expression systems can be employed based on general recombinant protein expression principles:

  • Promoter Selection: The T7 promoter system is highly effective for recombinant protein expression in E. coli. The pET plasmid system, which utilizes T7 RNA polymerase, offers tight control and high-level expression capabilities .

  • Expression Strain Selection: BL21(DE3) and its derivatives are commonly used for recombinant protein expression due to their deficiency in key proteases (lon and ompT) .

  • Induction Strategies: For T7-based systems, IPTG induction is standard, but auto-induction media can provide higher yields with less monitoring required .

  • Affinity Tags: For purification purposes, adding a His-tag or other affinity tag is recommended. Consider the following options:

Tag TypeSizeAdvantagesDisadvantages
His-tag6-10 aaSimple purification, minimal impact on structureMay affect metal-binding proteins
GST26 kDaEnhances solubility, single-step purificationLarge size may affect function
MBP42 kDaSignificantly enhances solubilityLarge size, may require tag removal
Strep-tag8 aaMild elution conditions, high specificityHigher cost of resin

For gltF specifically, since it contains a signal peptide that targets it to the periplasm, careful consideration must be given to whether this signal peptide should be included in the recombinant construct or if cytoplasmic expression is preferred .

What is the current understanding of gltF's function in E. coli?

The function of gltF has been a subject of debate in the scientific literature. Initially, it was suggested that gltF might have regulatory functions in nitrogen metabolism . This was primarily based on the observation that mutations in the glt operon affected both glutamate synthase activity and the ability of cells to utilize alternative nitrogen sources.

The periplasmic localization of GltF, confirmed by signal peptide cleavage studies, further indicates that its function may be distinct from that of the glutamate synthase subunits encoded by gltB and gltD . The exact physiological role of gltF remains to be fully elucidated, presenting an important area for future research.

How does gltF relate to nitrogen metabolism in E. coli?

The relationship between gltF and nitrogen metabolism has been investigated through targeted gene disruption and complementation studies. The gltB and gltD genes encode the large and small subunits of glutamate synthase, which plays a crucial role in ammonia assimilation during nitrogen limitation .

  • A gltF::Km(R) insertion mutant showed no detectable phenotype with respect to amino acid utilization or ammonium transport .

  • Complementation tests demonstrated that plasmids carrying gltB+ only complemented cells for glutamate synthase activity, while plasmids carrying the entire gltB+D+F+ operon complemented all three mutant phenotypes associated with a polar gltB225::Ω1 mutation .

  • The presence of a signal peptide and periplasmic localization of gltF suggests a function distinct from cytoplasmic nitrogen regulation .

This body of evidence indicates that the initial association of gltF with nitrogen regulatory functions was likely due to polar effects of mutations on the entire operon rather than a direct functional role of gltF itself in nitrogen metabolism.

How do mutations in gltF affect E. coli physiology?

Contrary to what might be expected for a gene involved in a major metabolic pathway, targeted disruption of gltF produces no obvious phenotypic effects on E. coli growth or nitrogen metabolism. A gltF::Km(R) insertion mutant showed no detectable phenotype with respect to amino acid utilization or ammonium transport, suggesting that gltF is not essential for these processes .

This lack of a clear phenotype presents a significant challenge for researchers attempting to elucidate the function of gltF. It suggests several possibilities:

  • gltF may serve a redundant function, with other genes compensating for its loss.

  • Its role may be important only under specific environmental conditions not typically tested in laboratory settings.

  • The protein may be involved in subtle aspects of bacterial physiology that require more sophisticated analytical methods to detect.

These observations highlight the need for more comprehensive phenotypic analyses, perhaps using global approaches such as transcriptomics, proteomics, or metabolomics to uncover subtle effects of gltF mutations.

What are the recommended methods for studying gltF expression and regulation?

To effectively study gltF expression and regulation, several methodological approaches can be employed:

  • Transcriptional Analysis:

    • qRT-PCR to quantify gltF mRNA levels under various conditions

    • Northern blotting with probes specific to different regions of the gltBDF operon to detect polycistronic and monocistronic transcripts

    • RNA-seq to capture global transcriptional changes and potential regulatory networks

  • Promoter Analysis:

    • Reporter gene fusions (e.g., gltF-lacZ) to monitor promoter activity under different conditions

    • ChIP-seq to identify transcription factors binding to the gltF promoter region

    • In vitro binding assays with purified regulatory proteins

  • Protein Expression Analysis:

    • Western blotting with antibodies specific to gltF

    • Mass spectrometry-based proteomics to quantify gltF expression

    • Subcellular fractionation to confirm periplasmic localization

  • Condition-Dependent Expression:

    • Analyze expression under various nitrogen sources

    • Test expression during different growth phases

    • Examine expression under various stress conditions

Given the A/T-rich region between gltD and gltF that contains a weak promoter , special attention should be paid to potential condition-specific activation of this promoter, which might explain why gltF can be expressed independently of gltB and gltD under certain conditions.

What techniques are effective for purifying recombinant gltF protein?

Purification of recombinant gltF requires careful consideration of its characteristics, particularly its periplasmic localization and potential post-translational modifications. A comprehensive purification strategy would include:

  • Expression System Optimization:

    • Use E. coli BL21(DE3) or similar strains deficient in proteases

    • Consider periplasmic expression systems that include the native signal peptide for proper folding

    • Alternatively, use cytoplasmic expression with a fusion tag to enhance solubility

  • Affinity Chromatography:

    • His-tag purification using immobilized metal affinity chromatography (IMAC) is recommended for initial capture

    • If solubility is an issue, consider larger fusion tags like MBP or GST

  • Periplasmic Extraction Methods:

    • Osmotic shock procedure: This gentle method involves resuspending cells in a hypertonic solution followed by rapid dilution

    • Spheroplast formation: Treatment with lysozyme in the presence of EDTA to selectively release periplasmic contents

  • Further Purification Steps:

    • Ion exchange chromatography based on gltF's predicted isoelectric point

    • Size exclusion chromatography for final polishing and buffer exchange

  • Tag Removal:

    • If a protease cleavage site was incorporated, enzymatic removal of the tag

    • Re-purification to separate the cleaved protein from the tag

For researchers specifically interested in functional studies, ensuring the proper folding of gltF is critical. The recombinant production method should be validated by comparing the properties of the purified protein with those predicted from sequence analysis or, ideally, with the native protein isolated from E. coli.

How can computational approaches aid in understanding gltF function?

Given the challenges in determining gltF function experimentally, computational approaches can provide valuable insights:

  • Sequence-Based Analysis:

    • Homology detection through sensitive sequence comparison tools like PSI-BLAST or HHpred

    • Domain architecture analysis to identify functional units

    • Analysis of conserved residues across homologs from diverse species

  • Structural Predictions:

    • Protein structure prediction using AlphaFold2 or RoseTTAFold

    • Ligand binding site prediction

    • Protein-protein interaction surface analysis

  • Genomic Context Analysis:

    • Examination of gene neighborhoods across different bacterial species

    • Phylogenetic profiling to identify co-evolving genes

    • Identification of horizontal gene transfer events

  • Network Analysis:

    • Integration of transcriptomic and proteomic data to place gltF in functional networks

    • Guilt-by-association approaches using co-expression data

    • Metabolic modeling to predict potential roles in cellular metabolism

  • Machine Learning Applications:

    • Function prediction using ensemble methods that integrate multiple feature types

    • Identification of condition-specific expression patterns

    • Prediction of potential protein-protein interactions

Computational analysis has revealed that the gltF gene contains a signal sequence for periplasmic localization , which provides an important clue about its function. Further computational studies could help predict potential binding partners or substrates for gltF, guiding experimental verification.

How do we reconcile contradictory findings about gltF's role in nitrogen metabolism?

The literature contains seemingly contradictory findings regarding gltF's role in nitrogen metabolism. These contradictions can be reconciled through careful analysis of the experimental approaches used:

This case illustrates the importance of using precise genetic tools and considering the potential for polar effects when interpreting phenotypes of operon mutations. It also demonstrates how structural insights can provide crucial context for functional studies.

What is the relationship between gltF and the glutamate synthase enzyme complex?

The relationship between gltF and the glutamate synthase enzyme complex (encoded by gltB and gltD) remains incompletely understood, with several possibilities to consider:

  • Genetic relationship: While gltF is part of the same operon as gltB and gltD , its protein product does not appear to be a structural component of the glutamate synthase enzyme complex.

  • Functional independence: The lack of phenotype in gltF mutants with respect to nitrogen metabolism suggests functional independence from glutamate synthase activity.

  • Spatial separation: The periplasmic localization of gltF physically separates it from the cytoplasmic glutamate synthase, further supporting functional distinction.

  • Evolutionary considerations: The conservation of this genetic arrangement across different bacterial species suggests there may be some advantage to the co-regulation of these genes, even if their products function in different cellular compartments.

  • Potential regulatory relationship: One hypothesis that hasn't been fully explored is whether gltF might indirectly influence glutamate synthase activity through signaling pathways that connect periplasmic events to cytoplasmic metabolic regulation.

Further research is needed to elucidate whether there exists any functional relationship between gltF and glutamate synthase, perhaps under specific environmental conditions not yet tested.

What experimental approaches could resolve outstanding questions about gltF function?

Several experimental approaches could help resolve the outstanding questions regarding gltF function:

  • Comprehensive phenotypic screening:

    • Test gltF mutants under diverse environmental conditions, including various stressors

    • Use global phenotypic profiling methods like Biolog plates

    • Conduct competition assays between wild-type and gltF mutant strains

  • High-resolution localization studies:

    • Super-resolution microscopy with fluorescently tagged gltF

    • Immunogold electron microscopy to determine precise subcellular localization

    • BiFC or FRET approaches to identify proximal protein partners

  • Interaction partner identification:

    • Affinity purification-mass spectrometry to identify binding partners

    • Bacterial two-hybrid screening

    • Crosslinking studies followed by pull-down assays

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM of purified gltF

    • NMR spectroscopy for dynamic analyses

    • Hydrogen-deuterium exchange mass spectrometry to map functional regions

  • Systems biology integration:

    • Multi-omics integration comparing wild-type and gltF mutants

    • Flux analysis to detect subtle metabolic shifts

    • Network analysis to position gltF in the context of cellular pathways

  • Evolutionary analysis across species:

    • Complementation studies with gltF homologs from diverse bacteria

    • Correlation of gltF presence/absence with specific metabolic capabilities

    • Analysis of selection pressure on different regions of the protein

These approaches, especially when used in combination, have the potential to resolve the function of gltF and explain why it is maintained in the genome despite the lack of an obvious phenotype in laboratory conditions.

How have advancements in protein expression technologies improved gltF production?

Recent advancements in recombinant protein expression technologies have significantly improved the potential for efficient gltF production:

  • Expression system refinements:

    • Development of specialized E. coli strains for problematic proteins, such as those with rare codons or disulfide bonds

    • Implementation of auto-induction methods that eliminate the need for monitoring culture density before induction

    • Advancements in glycosylation pathways in E. coli for proteins requiring this modification

  • Fusion tag innovations:

    • New fusion partners designed specifically for periplasmic expression

    • Development of self-cleaving tags that eliminate the need for protease treatment

    • Tags designed to enhance specific properties like solubility or detection sensitivity

  • Process optimization through experimental design:

    • Implementation of Design of Experiments (DoE) methodologies to systematically optimize expression conditions

    • Statistical approaches that can identify complex interactions between variables affecting protein expression

    • For example, one study achieved high levels (250 mg/L) of soluble recombinant protein expression through systematic experimental design

  • Machine learning applications:

    • Development of predictive models for protein expression optimization

    • Closed-loop learning systems where experimental results feed back into model refinement

    • As demonstrated in a study using supervised learning in combination with DNA synthesis and high-throughput screening to improve protein design

  • Novel folding approaches:

    • Better understanding of disulfide bond formation in the periplasm

    • Controlled aggregation strategies that can actually enhance yield of functional protein

    • Co-expression of chaperones specifically designed for periplasmic proteins

These advancements collectively provide researchers with a more sophisticated toolkit for expressing challenging proteins like gltF, which contains a signal peptide and is naturally targeted to the periplasm .

What role might gltF research play in the broader context of E. coli systems biology?

Research on gltF has potential implications for the broader field of E. coli systems biology:

  • Network completion:

    • Identifying the function of gltF would fill a gap in our understanding of E. coli's functional genome

    • Comprehensive understanding of all genes is essential for accurate whole-cell modeling

    • As noted in systems biology literature, even genes without obvious phenotypes play important roles in cellular robustness

  • Periplasmic proteome characterization:

    • Better understanding of periplasmic proteins like gltF contributes to a more complete picture of compartmentalized cellular processes

    • The periplasm serves as an interface between the cell and its environment, making it relevant for stress responses and adaptation

    • Periplasmic proteins often serve as sensors or first responders to environmental changes

  • Operon organization principles:

    • The gltBDF operon presents an interesting case where functionally distinct proteins are co-transcribed

    • Understanding the evolutionary and regulatory logic behind this organization could provide insights into bacterial genome evolution

    • This research contributes to our understanding of how bacteria organize their genomes for efficient resource utilization

  • Integration with multi-omics data:

    • gltF research can be integrated with existing transcriptomic, proteomic, and metabolomic datasets

    • Such integration could reveal condition-specific functions not apparent from single-gene studies

    • As systems biology moves toward multi-scale modeling, incorporating periplasmic processes becomes increasingly important

  • Potential applications in protein production:

    • Understanding periplasmic protein processing could improve recombinant protein production strategies

    • E. coli remains the most common expression system for research laboratories

    • Insights from gltF studies might be applicable to other periplasmic proteins of commercial or medical interest

The integration of gltF research into systems biology frameworks would contribute to a more holistic understanding of cellular function in E. coli and potentially in other gram-negative bacteria.

How might advanced computational methods improve our understanding of gltF?

Advanced computational methods offer promising approaches to enhance our understanding of gltF:

  • Structure prediction and analysis:

    • AI-based structure prediction tools like AlphaFold2 can generate highly accurate protein structure models even without experimental data

    • These structural models can suggest functional regions, potential binding sites, and mechanism of action

    • For a periplasmic protein like gltF, structural information could reveal potential interaction interfaces with the inner or outer membrane

  • Integrative multi-omics analysis:

    • Machine learning approaches can integrate diverse omics datasets to place gltF in functional networks

    • Network inference algorithms might reveal hidden connections between gltF and other cellular processes

    • Condition-specific expression patterns could provide clues about when gltF function becomes important

  • Diffusion models for protein design and analysis:

    • Recent advances in protein design using diffusion models like RFdiffusion could be applied to study gltF variants

    • These models could predict the impact of mutations on gltF structure and function

    • Generation of synthetic variants might reveal functional constraints on the protein sequence

  • Molecular dynamics simulations:

    • Simulations of gltF in a model periplasmic environment could reveal dynamic properties

    • Potential conformational changes under different conditions might suggest activation mechanisms

    • Interaction simulations with potential binding partners could guide experimental validation

  • Evolutionary sequence analysis:

    • Advanced phylogenetic methods analyzing rates of evolution at different sites in the protein

    • Detection of co-evolving residues within gltF or between gltF and other proteins

    • Identifying critical functional residues through evolutionary conservation patterns

  • Machine learning for phenotype prediction:

    • Development of models that can predict subtle phenotypic effects of gltF mutation under specific conditions

    • Integration of genomic, transcriptomic, and phenotypic data across multiple bacterial species

    • Identification of conditions where gltF function becomes essential or advantageous

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.