Recombinant Escherichia coli Protein hdeD (hdeD)

Shipped with Ice Packs
In Stock

Description

Genomic Context

The hdeD gene is part of the GAD gene cluster in E. coli, which plays a critical role in acid resistance mechanisms. Alternative gene identifiers include yhiA, b3511, and JW3479, which are important for cross-referencing in genomic databases . The genomic location of hdeD places it in proximity to other acid stress response genes, suggesting coordinated regulation and functional relationships.

Transcriptional Regulation

The expression of hdeD is tightly regulated by environmental conditions and specific transcriptional regulators. The promoter activity of hdeD exhibits interesting patterns based on growth conditions. Research has demonstrated that the hdeD promoter is induced when E. coli is grown in M9 glycerol medium but shows minimal activity in Luria-Bertani (LB) broth . This differential expression is attributed to gene silencing by the nucleoid-associated protein H-NS in rich media .

A key finding is that hdeD promoter activation requires the master regulator GadE, which controls the GAD acid stress response system . This GadE-dependent expression mechanism connects hdeD function directly to the bacterial acid stress response pathway, providing insight into its physiological role in E. coli survival under acidic conditions .

Role in Acid Stress Response

As a component of the GAD cluster, hdeD contributes to E. coli's ability to survive extreme acid stress, particularly relevant as the bacterium passes through the mammalian digestive system. The pH of gastric juice can drop below 2.0, requiring rapid bacterial adaptation . The GAD system is one of the primary mechanisms that E. coli employs to counteract this acid stress.

The membrane-embedded nature of hdeD suggests it may function as a pH sensor, detecting changes at the cytoplasmic membrane interface . This sensing capability could trigger downstream responses that prepare the cell for changing environmental conditions as bacteria transit through the digestive tract, from the highly acidic stomach to the less acidic intestinal environment .

Regulation of Flagellar Biosynthesis

One of the most significant discoveries regarding hdeD function comes from transcriptome analysis of hdeD-deficient (ΔhdeD) mutants. When the hdeD gene is deleted, there is substantial upregulation of genes involved in flagellum biosynthesis, motility, and chemotaxis . Specifically, transcripts of 53 genes related to these functions showed significant increases in the ΔhdeD strain compared to the parent strain .

This regulatory effect occurs through a specific molecular pathway. HdeD activates the promoter of the lrhA gene, which encodes a transcriptional repressor of the flhDC operon - the master regulator of flagellar gene expression . When hdeD is absent, lrhA expression decreases, leading to derepression of flhDC and consequently increased expression of flagellar genes .

Table 2: Effects of hdeD Deficiency on Flagellar Gene Expression

ObservationΔhdeD Mutant vs. Parent Strain
Upregulated genes70 genes (log₁₀ratio > 0.45)
Flagellar synthesis genes53 genes significantly upregulated
lrhA promoter activityDecreased by more than 2-fold
Cell motilitySignificantly increased
Flagellar filamentsIncreased number (confirmed by electron microscopy)

These findings establish hdeD as a negative regulator of flagellar biosynthesis in E. coli, linking acid stress response to motility control .

Energy Conservation Mechanism

The relationship between acid stress response and flagellar repression via hdeD represents an elegant energy conservation strategy in E. coli. Flagellar biosynthesis and operation are energetically expensive processes, requiring significant ATP and protein resources . By repressing flagellum production during acid stress, E. coli can redirect energy toward survival mechanisms more critical for immediate survival.

This is particularly relevant when E. coli utilizes low respiratory quotient nutrients such as glycerol, where careful management of proton motive force is essential . The hdeD protein may sense slight pH changes in the range between 7 and 8, regulating flagellar numbers to maintain appropriate levels of proton motive force for growth .

Adaptive Advantage in Host Colonization

The dual function of hdeD in acid resistance and motility regulation provides E. coli with an adaptive advantage during host colonization. As bacteria enter the mammalian digestive system, they encounter sequential environments with varying pH levels and nutrient availability . The ability to respond to these changes efficiently determines their survival and colonization success.

By suppressing flagellar biosynthesis during transit through acidic environments, E. coli not only conserves energy but also potentially reduces immune stimulation, as flagellar proteins are highly immunogenic . Once the bacteria reach the intestines where conditions are more favorable for colonization, the regulation of motility can be adjusted according to environmental cues.

Experimental Tools and Recombinant Protein Usage

Recombinant hdeD protein serves as an essential tool for investigating bacterial stress response mechanisms and membrane protein function. The availability of purified protein with high purity (>90%) enables various biochemical and structural studies . The N-terminal histidine tag facilitates protein purification through affinity chromatography, allowing researchers to obtain sufficient quantities for functional and structural analyses.

The reconstitution protocols for lyophilized hdeD protein have been optimized to maintain protein stability and function, with recommendations for glycerol addition to prevent freeze-thaw damage . These technical advancements support ongoing research into the molecular mechanisms of hdeD activity.

Potential Therapeutic Applications

Understanding hdeD function opens avenues for potential therapeutic interventions targeting bacterial colonization and virulence. Since hdeD affects both acid resistance and motility - two factors critical for successful pathogen establishment - it represents a potential target for novel antimicrobial strategies.

Inhibitors targeting hdeD might disrupt the bacterium's ability to navigate the harsh gastric environment or establish intestinal colonization. Alternatively, manipulating hdeD expression could potentially attenuate pathogenic strains for vaccine development or probiotic engineering.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
hdeD; yhiA; b3511; JW3479; Protein HdeD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
hdeD
Target Protein Sequence
MLYIDKATILKFDLEMLKKHRRAIQFIAVLLFIVGLLCISFPFVSGDILSTVVGALLICS GIALIVGLFSNRSHNFWPVLSGFLVAVAYLLIGYFFIRAPELGIFAIAAFIAGLFCVAGV IRLMSWYRQRSMKGSWLQLVIGVLDIVIAWIFLGATPMVSVTLVSTLVGIELIFSAASLF SFASLFVKQQ
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the hdeD gene in E. coli and what is its primary function?

The hdeD gene is one of the GAD (glutamate-dependent acid resistance) cluster genes in E. coli that encodes a membrane protein. Research indicates that HdeD plays a crucial role in linking acid resistance mechanisms to flagellum biosynthesis regulation. Specifically, HdeD in the GAD system activates the lrhA promoter, resulting in decreased flagellar filaments in E. coli cells .

To investigate this function, researchers should consider:

  • Knockout studies comparing parent strains with ΔhdeD mutants

  • Promoter-reporter fusion assays to monitor expression

  • Transcriptome analysis to identify affected pathways

  • Motility assays on semi-solid agar to measure phenotypic effects

How is the hdeD gene regulated in E. coli?

The hdeD promoter is induced in a GadE-dependent manner when E. coli is grown in M9 glycerol medium . GadE functions as a transcriptional regulator for the glutamate-dependent acid resistance system. For studying hdeD regulation:

  • Use reporter assays (e.g., lacZ or GFP fusions) to monitor promoter activity

  • Compare expression in wild-type and ΔgadE strains

  • Test various growth conditions including different carbon sources and pH levels

  • Employ chromatin immunoprecipitation (ChIP) to confirm GadE binding to the hdeD promoter

What is the relationship between hdeD and bacterial motility?

Transcriptome analysis has revealed that hdeD deficiency results in increased expression of genes involved in flagellum synthesis . Cell motility increases in both hdeD-deficient and gadE-deficient mutants, with transmission electron microscopy showing increased flagellar filaments in these mutant strains compared to wild-type .

StrainRelative MotilityFlagella Number (avg.)FliA Levels
Wild-type1.0 (baseline)++
ΔhdeDIncreased++++++
ΔgadEIncreased++++++
ΔlrhAIncreased+++++++

Note: This table represents typical experimental findings reported in literature .

How should I design experiments to study hdeD function in E. coli?

When designing experiments to study hdeD function, consider these experimental design principles:

  • Replication requirements:

    • Include biological replicates (minimum 3) to estimate experimental error

    • Distinguish between true replications and subsamples

    • Increase replication to improve precision by reducing standard deviation

  • Treatment considerations:

    • Include appropriate controls (wild-type, vector-only, complemented mutant)

    • Test multiple conditions (pH, temperature, growth phase)

    • Use randomization to eliminate bias

  • Error control strategies:

    • Implement blocking techniques

    • Control environmental factors using growth chambers

    • Select appropriate size and shape of experimental units

What are effective methods for producing recombinant HdeD protein?

For recombinant HdeD production, E. coli remains the preferred expression system due to its versatility and well-established protocols . Consider this methodology:

  • Vector selection and cloning:

    • Choose an appropriate expression vector (pET system recommended for membrane proteins)

    • Include affinity tags (6×His) for purification

    • Consider fusion partners (GFP, MBP) to improve solubility

  • Expression optimization:

    • Test multiple E. coli strains (BL21(DE3), Origami)

    • Vary induction conditions (temperature, IPTG concentration, duration)

    • Consider specialized media formulations

  • Purification strategy:

    • Use immobilized metal affinity chromatography (IMAC) with Ni-NTA

    • Include detergents for membrane protein solubilization

    • Implement size exclusion chromatography for final polishing

How does hdeD influence the molecular pathway of flagellum biosynthesis?

The molecular pathway connecting hdeD to flagellum biosynthesis involves several key steps:

  • HdeD activates the lrhA promoter

  • LrhA functions as a repressor for the flhDC operon

  • FlhDC acts as the master regulator for flagellum synthesis

  • FlhDC activates FliA, an alternative sigma factor

  • FliA directs RNA polymerase to transcribe flagellar genes

In hdeD-deficient cells, this regulatory pathway is disrupted, leading to decreased lrhA expression, increased flhDC expression, higher FliA levels, and ultimately more flagellar filaments and increased motility .

To investigate this pathway:

  • Perform quantitative RT-PCR to measure expression levels of pathway components

  • Use ChIP-seq to identify genome-wide binding sites

  • Implement CRISPR interference to modulate expression of pathway genes

  • Employ reporter fusions to monitor promoter activities in real-time

What challenges exist in producing soluble HdeD protein and how can they be addressed?

As a membrane protein, HdeD presents several production challenges that can be addressed through targeted approaches:

  • Challenge: Insolubility and inclusion body formation

    • Solution: Use fusion partners like GFP that can prevent non-productive aggregation

    • Alternative: Explore controlled formation of aggregates that retain function

  • Challenge: Proper disulfide bond formation

    • Solution: Express in specialized strains with oxidizing cytoplasm (Origami)

    • Alternative: Co-express with sulfhydryl oxidase and isomerase

    • Recent approach: Implement switchable systems that trigger passage from reducing to oxidizing cytoplasm conditions during the stationary phase

  • Challenge: Post-translational modifications

    • Solution: Use engineered E. coli strains with glycosylation capabilities

    • Recent development: Employ bacteria modified with O-glycosylation machinery

How can contradictory data regarding hdeD function be reconciled?

When facing contradictory results in hdeD research:

  • Systematic experimental approach:

    • Standardize experimental conditions across studies

    • Test multiple strains and growth conditions

    • Implement factorial experimental designs to identify interaction effects

  • Data integration methods:

    • Use meta-analysis approaches to combine datasets

    • Employ artificial intelligence tools to identify patterns in complex data

    • Note that AI training phases require systematic experimental approaches to collect uniform data

  • Address the metabolic burden question:

    • Quantify recombinant protein expression levels

    • Measure growth parameters under various conditions

    • Assess metabolic markers to determine physiological impacts

What are the best methods for monitoring HdeD localization in live cells?

To monitor HdeD localization:

  • Generate fluorescent protein fusions (EGFP or mCherry) to the C-terminus of HdeD

  • Express these constructs using controlled induction systems

  • Visualize using confocal microscopy to determine membrane localization

  • Confirm findings with fractionation studies and western blotting

For higher resolution:

  • Implement super-resolution microscopy techniques (STORM, PALM)

  • Use immunogold labeling with transmission electron microscopy

  • Consider FRET approaches to study protein-protein interactions

How can I design experiments to investigate the pH-sensing capabilities of HdeD?

Since HdeD may function in sensing pH changes at the cytoplasmic membrane , consider:

  • pH-dependent activity assays:

    • Measure flagellar gene expression at various pH values

    • Use fluorescent pH indicators to correlate cellular pH with HdeD activity

    • Implement microfluidic devices for rapid pH shifts during live-cell imaging

  • Mutagenesis studies:

    • Generate point mutations in potential pH-sensing residues

    • Create chimeric proteins with known pH sensors

    • Perform alanine-scanning mutagenesis to identify critical residues

  • Biophysical characterization:

    • Measure protein conformational changes at different pH using circular dichroism

    • Employ hydrogen-deuterium exchange mass spectrometry

    • Implement patch-clamp techniques if HdeD functions as an ion channel

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.