Recombinant Escherichia coli Protein phsC homolog (ydhU)

What is the basic structure and function of Recombinant Escherichia coli Protein phsC homolog (ydhU)?

The Recombinant Escherichia coli Protein phsC homolog (ydhU) is a protein originally derived from E. coli strain K12, identified with UniProt number P77409. The protein features 261 amino acids in its expression region, with the full amino acid sequence including multiple transmembrane regions as indicated by the hydrophobic stretches in its sequence . The amino acid sequence (MNPSQHAEQFQSQLANYVPQFTPEFWPVWLIIAGVLLVGMWLVLGLHALLRARGVKKSAT DHGEKIYLYSKAVRLWHWSNALLFVLLLASGLINHFAMVGATAVKSLVAVHEVCGFLLLA CWLGFVLINAVGDNGHHYRIRRQGWLERAAKQTRFYLFGIMQGEEHPFPATTQSKFNPLQ QVAYVGVMYGLLPLLLLTGLLCLYPQAVGDVFPGVRYWLLQTHFALAFISLFFIFGHLYL CTTGRTPHETFKSMVDGYHRH) suggests membrane-associated functions, potentially related to ion transport or membrane integrity.

As a homolog of phsC, it likely shares functional similarities with the thiosulfate reductase cytochrome b subunit, though its exact physiological role remains under investigation. Experimental approaches for functional characterization typically include gene knockout studies, complementation assays, and protein-protein interaction analyses.

What are the optimal storage conditions for maintaining recombinant ydhU protein stability?

For optimal stability of the Recombinant Escherichia coli Protein phsC homolog (ydhU), the protein should be stored in a Tris-based buffer containing 50% glycerol . Short-term storage at 4°C is suitable for up to one week for working aliquots. For extended preservation, storage at -20°C is recommended, while -80°C provides maximum stability for long-term archiving .

Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided. Researchers should prepare small working aliquots to minimize freeze-thaw events. When handling the protein, maintain a consistent cold chain and consider adding protease inhibitors if degradation is observed during experimental procedures. Stability studies using circular dichroism or differential scanning fluorimetry can help establish optimal buffer conditions for specific experimental requirements.

How is the expression and purification of recombinant ydhU typically performed?

Expression and purification of Recombinant Escherichia coli Protein phsC homolog (ydhU) typically involves heterologous expression systems optimized for membrane proteins, given its hydrophobic nature. The expression region (1-261) can be cloned into appropriate expression vectors with suitable affinity tags . Common methodological approaches include:

• Expression system selection: BL21(DE3) or C41/C43 E. coli strains are often preferred for membrane protein expression

• Vector design: pET series vectors with T7 promoter systems and appropriate affinity tags (His6, GST, or MBP) to facilitate purification

• Culture conditions: Lower induction temperatures (16-25°C) to enhance proper folding

• Cell lysis: Gentle disruption methods using specialized detergents like DDM or CHAPS to solubilize membrane proteins

• Purification: IMAC (Immobilized Metal Affinity Chromatography) for His-tagged constructs, followed by size exclusion chromatography

The final purified protein is typically stored in the Tris-based buffer with 50% glycerol as described in the product information . Researchers should optimize each step based on their specific experimental goals and downstream applications.

What methodological approaches are most effective for studying protein-protein interactions of ydhU in E. coli?

The investigation of protein-protein interactions for the ydhU protein (Ordered Locus Names: b1670, JW1660) requires specialized techniques that account for its membrane-associated nature . Methodological approaches include:

For the phsC homolog (ydhU), proximity labeling techniques like BioID are particularly valuable as they can capture the membrane protein interactome while maintaining the native membrane context. When designing these experiments, researchers should include appropriate controls to account for non-specific interactions common with hydrophobic membrane proteins.

How can functional analysis of the ydhU gene be performed to understand its role in E. coli metabolism?

Functional analysis of the ydhU gene requires a multifaceted approach to elucidate its metabolic role, particularly given its potential relationship to thiosulfate metabolism as a phsC homolog. Methodological strategies include:

• Transcriptional analysis: Quantitative RT-PCR and RNA-seq to determine expression patterns under various growth conditions, particularly focusing on sulfur metabolism stress conditions.

• Gene knockout and complementation: Creating precise deletions using CRISPR-Cas9 or λ-Red recombination systems to generate ΔydhU strains, followed by phenotypic analysis and complementation with the wild-type gene.

• Metabolomic profiling: Comparative metabolomics of wild-type versus ΔydhU strains using LC-MS/MS to identify metabolic pathways affected by ydhU deletion.

• Growth phenotyping: High-throughput phenotypic microarrays to compare growth of wild-type and ΔydhU strains across hundreds of nutrient and stress conditions.

• Protein localization: Fluorescent protein fusions to confirm membrane localization and potential association with specific membrane regions or protein complexes.

For researchers studying ydhU's potential role in sulfur metabolism, anaerobic growth conditions with thiosulfate as an electron acceptor would be particularly relevant for phenotypic analysis, given the protein's homology to phsC.

What are the challenges in crystallizing membrane proteins like ydhU, and what alternative structural determination methods are available?

Crystallization of membrane proteins like ydhU presents significant challenges due to their hydrophobic nature. The protein's amino acid sequence reveals multiple hydrophobic regions indicative of transmembrane domains , complicating structural studies. The methodological challenges and alternative approaches include:

Challenges in crystallization:

• Maintaining protein stability outside the membrane environment

• Finding appropriate detergents that mimic the native lipid environment

• Obtaining sufficient protein quantities with homogeneous conformation

• Limited polar surfaces for crystal contact formation

Alternative structural determination approaches:

How can researchers effectively design experiments to investigate post-translational modifications of ydhU protein?

Investigating post-translational modifications (PTMs) of the ydhU protein requires specialized experimental approaches. Based on its sequence and potential membrane localization , methodological considerations include:

• Prediction and targeted analysis: Use computational tools to predict likely PTM sites based on the amino acid sequence (MNPSQHAEQFQSQLANYVPQFTPEFWPVWLIIAGVLLVGMWLVLGLHALLRARGVKKSAT DHGEKIYLYSKAVRLWHWSNALLFVLLLASGLINHFAMVGATAVKSLVAVHEVCGFLLLA CWLGFVLINAVGDNGHHYRIRRQGWLERAAKQTRFYLFGIMQGEEHPFPATTQSKFNPLQ QVAYVGVMYGLLPLLLLTGLLCLYPQAVGDVFPGVRYWLLQTHFALAFISLFFIFGHLYL CTTGRTPHETFKSMVDGYHRH) provided in the product information.

• Mass spectrometry-based approaches:

  • Enrich the protein using the recombinant version with appropriate tags

  • Perform bottom-up proteomics with specialized digestion protocols for membrane proteins

  • Use targeted multiple reaction monitoring (MRM) for specific PTM sites

  • Apply electron transfer dissociation (ETD) for labile modifications

• PTM-specific enrichment strategies:

  • Phosphorylation: Titanium dioxide or immobilized metal affinity chromatography

  • Glycosylation: Lectin affinity chromatography

  • Ubiquitination: Ubiquitin remnant antibody enrichment

• Site-directed mutagenesis of predicted PTM sites to assess functional consequences

• PTM-specific antibodies for Western blot verification of major modifications

The experimental design should include appropriate controls, such as dephosphorylation treatments or expression in PTM-deficient systems, to validate findings. Researchers should be particularly attentive to modifications common in membrane proteins, such as palmitoylation or prenylation, which may affect membrane association or protein-protein interactions.

How does the ydhU protein contribute to the broader understanding of membrane protein biology in prokaryotes?

The ydhU protein (Protein phsC homolog) serves as an important model for understanding fundamental aspects of membrane protein biology in prokaryotes. As a protein with multiple predicted transmembrane domains , ydhU exemplifies several key aspects of membrane protein biology:

• Membrane protein folding and topology: The amino acid sequence of ydhU contains multiple hydrophobic regions that likely form transmembrane helices, providing insight into how membrane proteins achieve their native conformation within the lipid bilayer.

• Protein targeting and insertion: The mechanisms by which ydhU is targeted to and inserted into the membrane can illuminate general principles of the Sec or YidC translocation pathways in prokaryotes.

• Evolutionary conservation of membrane proteins: As a homolog of phsC, comparative analysis of ydhU across bacterial species can reveal conserved structural and functional elements essential for membrane protein function.

• Membrane protein complex assembly: If ydhU participates in larger protein complexes, it can serve as a model for understanding how membrane protein subunits assemble into functional complexes within the constraints of the lipid environment.

Researchers studying ydhU contribute to the broader field by developing methodologies that overcome the technical challenges inherent to membrane protein research, potentially advancing techniques applicable to other membrane protein systems in both prokaryotes and eukaryotes.

What is the current understanding of ydhU expression regulation in different growth conditions?

The regulation of ydhU gene expression (Ordered Locus Names: b1670, JW1660) under different growth conditions remains an area requiring further investigation. Current methodological approaches for studying its regulation include:

• Transcriptional profiling: RNA-seq and microarray data from E. coli grown under various conditions can reveal patterns of ydhU expression. Preliminary data suggests potential regulation in response to:

  • Anaerobic growth conditions

  • Sulfur compound availability

  • Acid stress

  • Stationary phase entry

• Promoter analysis: The upstream regulatory region of ydhU can be analyzed for transcription factor binding sites and other regulatory elements. Computational predictions combined with experimental verification through:

  • Promoter-reporter fusions (e.g., lacZ, GFP)

  • Chromatin immunoprecipitation (ChIP) to identify bound transcription factors

  • DNA footprinting to precisely map protein-DNA interactions

• Transcription factor identification: Potential regulators can be assessed through:

  • Transcriptomic analysis of transcription factor knockout strains

  • Electrophoretic mobility shift assays (EMSA) with purified transcription factors

  • Bacterial one-hybrid systems to screen for interacting transcription factors

• Post-transcriptional regulation: Analysis of mRNA stability and potential sRNA interactions through:

  • RNA half-life measurements

  • sRNA prediction tools

  • RNA immunoprecipitation methods

For researchers investigating ydhU regulation, experimental designs that mimic physiologically relevant conditions, particularly those related to sulfur metabolism and anaerobic respiration, would be most informative given the protein's homology to phsC.

How do the structural and functional properties of ydhU compare to other phsC homologs across bacterial species?

Comparative analysis of the ydhU protein with other phsC homologs across bacterial species provides valuable evolutionary and functional insights. Based on its amino acid sequence and classification as a phsC homolog , the following methodological approaches are recommended:

• Sequence-based phylogenetic analysis:

  • Multiple sequence alignment of ydhU (P77409) with phsC homologs from diverse bacterial species

  • Construction of phylogenetic trees to visualize evolutionary relationships

  • Identification of conserved domains and critical residues

• Structural comparison:

  • Homology modeling based on available structures of related proteins

  • Comparison of predicted transmembrane topology across homologs

  • Analysis of conserved structural motifs in the membrane domains

• Functional domain analysis:

  • Identification of conserved functional domains across phsC homologs

  • Analysis of substrate binding sites and catalytic residues

  • Examination of protein-protein interaction interfaces

The table below summarizes key comparative features across selected bacterial phsC homologs:

This comparative approach not only illuminates the evolutionary history of ydhU but also helps predict functional roles based on conservation patterns across species, particularly in relation to membrane-associated functions and potential roles in sulfur metabolism.

What methodological approaches can be used to determine if ydhU is essential for E. coli survival under specific conditions?

Determining whether the ydhU gene (b1670, JW1660) is essential for E. coli survival under specific conditions requires systematic experimental approaches that precisely assess gene function across various environments. Recommended methodological strategies include:

• Targeted gene deletion:

  • CRISPR-Cas9 or λ-Red recombineering to create clean ydhU deletion strains

  • Complementation with wild-type ydhU to confirm phenotypes are directly attributable to the deletion

  • Construction of conditional mutants (inducible promoters) if direct deletion is lethal

• High-throughput phenotypic screening:

  • Phenotype microarrays (Biolog) to test growth across hundreds of conditions

  • Growth curve analysis under varying:

    • Carbon and nitrogen sources

    • Electron acceptors (particularly sulfur compounds)

    • pH values and osmotic conditions

    • Stress conditions (oxidative, acid, temperature)

• Competition assays:

  • Co-culture of wild-type and ΔydhU strains with differentiable markers

  • Quantification of relative fitness using flow cytometry or selective plating

  • Long-term evolution experiments to detect subtle fitness effects

• Genetic interaction mapping:

  • Synthetic genetic array (SGA) analysis with E. coli deletion collection

  • Double knockout studies to identify genetic redundancy

  • Suppressor screens to identify compensatory mutations

• In vivo relevance:

  • Colonization models to assess importance in host environments

  • Biofilm formation assays

  • Survival under immune system challenges

For researchers specifically interested in the potential role of ydhU in sulfur metabolism (given its homology to phsC), designing experiments that manipulate sulfur compound availability and test growth under anaerobic conditions with alternative electron acceptors would be particularly informative.

What are the most promising future research directions for understanding the biochemical and physiological roles of ydhU in E. coli?

The Recombinant Escherichia coli Protein phsC homolog (ydhU) represents an intriguing target for further investigation, with several promising research directions emerging from current knowledge . Future studies should focus on:

• Comprehensive functional characterization:

  • Systematic phenotypic analysis of ydhU deletion strains under varied growth conditions

  • Metabolomic profiling to identify affected pathways

  • Transcriptomic analysis to understand regulatory networks involving ydhU

• Structural biology approaches:

  • Cryo-EM studies of the full-length protein in membrane mimetics

  • Hybrid structural approaches combining computational modeling with experimental constraints

  • Structure-function relationship studies through targeted mutagenesis

• Protein interaction network mapping:

  • Systematic identification of protein partners using proximity labeling approaches

  • Validation of interactions through complementary methods

  • Reconstruction of membrane protein complexes involving ydhU

• Physiological context determination:

  • Investigation of potential roles in sulfur metabolism based on phsC homology

  • Assessment of contributions to membrane integrity and transport functions

  • Evaluation of roles in stress responses and adaptation

• Translational applications:

  • Exploration of ydhU as a potential drug target if found to be essential under specific conditions

  • Development of ydhU-based biosensors if specific ligand interactions are identified

  • Potential biotechnology applications based on its functional properties

Methodologically, integrating systems biology approaches with traditional biochemical and genetic techniques will likely yield the most comprehensive understanding of ydhU's roles. The amino acid sequence provided in the product information provides a foundation for designing targeted studies of structure-function relationships, while the genetic information (locus names b1670, JW1660) enables precise genomic manipulations in E. coli K12.