Recombinant Escherichia coli Protein sirB2 (sirB2)

Shipped with Ice Packs
In Stock

Description

Relationship to Other Bacterial Proteins

While sirB2 has been identified in E. coli, homologous proteins have been observed in other bacterial species, particularly within the Salmonella genus. Both Salmonella typhi and Salmonella typhimurium express proteins designated as sirB2 with notably similar characteristics to the E. coli version . The Salmonella variants contain 129 amino acid residues, slightly shorter than the 130-residue E. coli sirB2 . This conservation across related bacterial species suggests functional importance in bacterial physiology.

Recombinant Expression Systems

The production of recombinant sirB2 typically involves expression in E. coli systems. The protein is commonly produced with an N-terminal histidine tag (His-tag), which facilitates purification and detection . This approach allows for efficient isolation of the protein while maintaining its structural integrity. The expression construct generally encompasses the full-length protein sequence (amino acids 1-130), ensuring complete functional capacity .

Purification Techniques

Following expression, recombinant sirB2 undergoes purification procedures that leverage the affinity of the His-tag for metal ions. This process typically yields protein preparations with purity greater than 90% as determined by SDS-PAGE analysis . The purified product is subsequently lyophilized to create a stable powder formulation suitable for storage and distribution.

ParameterSpecification
Source organismEscherichia coli
Expression systemE. coli
Protein lengthFull Length (1-130)
TagHis (N-terminal)
FormLyophilized powder
Purity>90% (SDS-PAGE)

Reconstitution Protocol

The lyophilized sirB2 protein requires proper reconstitution before use in experimental applications. It is recommended to centrifuge the product vial briefly prior to opening to ensure the contents settle at the bottom . Reconstitution should be performed in deionized sterile water to achieve a concentration ranging from 0.1 to 1.0 mg/mL . The addition of glycerol to a final concentration of 5-50% is advisable for preparations intended for long-term storage, with 50% being the standard recommendation .

Current Research Applications

Recombinant sirB2 protein serves as a valuable tool in various research contexts, including:

  1. Structural biology studies investigating bacterial membrane proteins

  2. Development of antibacterial agents targeting specific bacterial proteins

  3. Comparative genomics and proteomics across different bacterial species

  4. Antibody production and immunological research

The availability of high-purity recombinant protein facilitates these investigations by providing standardized material for experimental procedures.

Analytical Methods for sirB2 Characterization

Several analytical techniques can be employed to characterize sirB2 and assess its interactions with other biomolecules:

Analytical TechniqueApplication to sirB2 Research
SDS-PAGEPurity assessment and molecular weight confirmation
Western BlottingDetection and quantification using anti-His antibodies
Circular DichroismSecondary structure analysis
Mass SpectrometryPrecise molecular weight determination and post-translational modifications
X-ray CrystallographyThree-dimensional structure elucidation
Nuclear Magnetic ResonanceSolution structure and dynamics

sirB2 in Different Bacterial Species

As previously noted, sirB2-like proteins have been identified in Salmonella species in addition to E. coli. The table below compares key characteristics of sirB2 across these bacterial species:

FeatureE. coli sirB2S. typhi sirB2S. typhimurium sirB2
Amino Acid Length130129129
Expression HostE. coliE. coliE. coli
TagHisHisHis
UniProt IDQ46755Not specified in search resultsNot specified in search results

This conservation suggests evolutionary importance, though functional implications remain to be fully elucidated.

Knowledge Gaps and Research Opportunities

Despite the availability of recombinant sirB2 for research purposes, significant knowledge gaps persist regarding its biological functions and mechanisms. Future research endeavors could productively focus on:

  1. Comprehensive functional characterization through knockout and overexpression studies

  2. Identification of interaction partners within bacterial cells

  3. Investigation of potential involvement in bacterial pathogenicity

  4. Structural determination through advanced crystallographic techniques

  5. Development of specific inhibitors as potential antimicrobial agents

These research avenues would contribute substantially to our understanding of sirB2's role in bacterial physiology and potentially reveal applications in biotechnology and medicine.

Technical Innovations in sirB2 Research

Emerging technologies in protein science offer promising approaches to advance sirB2 research:

  1. CRISPR-Cas9 genome editing for precise manipulation of sirB2 expression

  2. Cryo-electron microscopy for high-resolution structural analysis

  3. Single-molecule techniques to study protein dynamics

  4. Computational modeling to predict functional domains and interactions

  5. Proteomics approaches to identify post-translational modifications

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ychQ; sirB2; b1213; JW1204; Protein YchQ; Protein SirB2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ychQ
Target Protein Sequence
MTSFSTLLSVHLISIALSVGLLTLRFWLRYQKHPQAFARWTRIVPPVVDTLLLLSGIALM AKAHILPFSGQAQWLTEKLFGVIIYIVLGFIALDYRRMHSQQARIIAFPLALVVLYIIIK LATTKVPLLG
Uniprot No.

Target Background

Database Links
Protein Families
SirB2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is SIRT2 and why is it expressed recombinantly in E. coli?

SIRT2 is a member of the sirtuin family of proteins that function as NAD-dependent deacetylases. Sirtuins play crucial roles in epigenetic gene silencing and may have antiaging effects through suppression of DNA recombination . E. coli is the preferred host for recombinant SIRT2 production due to its fast growth rate, ease of genetic manipulation, and cost-effectiveness compared to mammalian expression systems . Additionally, E. coli can produce substantial quantities of functional SIRT2 protein that retains its enzymatic activity, making it suitable for structural and functional studies.

Which E. coli strain is most commonly used for SIRT2 expression?

BL21(DE3) and its derivatives are the most widely used E. coli strains for SIRT2 expression. These strains contain a chromosomally integrated T7 RNA polymerase gene under control of the lacUV5 promoter, allowing for inducible expression of proteins cloned under the T7 promoter using IPTG . For SIRT2 specifically, strains like Rosetta(DE3) that supply rare tRNAs can improve expression levels if the human SIRT2 sequence contains codons that are rare in E. coli .

What are the basic components needed for a SIRT2 expression system?

A complete SIRT2 expression system requires:

  • An appropriate E. coli strain (typically BL21(DE3) or derivatives)

  • An expression plasmid containing the SIRT2 gene under a T7 or similar inducible promoter

  • An affinity tag (commonly His-tag) for purification purposes

  • Appropriate selection markers (typically antibiotic resistance genes)

  • Optimal media and growth conditions

  • An induction system (usually IPTG for T7-based systems)

The commercially available recombinant SIRT2 is often produced with an N-terminal His-tag in E. coli and purified to >90% purity as determined by SDS-PAGE .

How can I optimize SIRT2 expression levels in E. coli?

Optimizing SIRT2 expression involves several strategies:

  • Strain selection: Beyond BL21(DE3), consider specialized strains like SixPack which has been engineered to express rare tRNAs coupled to translational capacity needs .

  • Expression conditions: Systematically test different temperatures (typically 16-37°C), IPTG concentrations (0.1-1.0 mM), and induction times (2-24 hours). Lower temperatures often improve soluble protein yield by slowing protein synthesis and folding.

  • Media optimization: Compare rich media (LB, TB) with defined media supplemented with appropriate carbon sources and nutrients.

  • Co-expression with chaperones: Consider co-expressing molecular chaperones to improve folding and solubility.

  • Codon optimization: Although strains like Rosetta can supply rare tRNAs, codon-optimizing the SIRT2 sequence for E. coli expression can further enhance yields.

ParameterRange to TestOptimal Conditions*
Temperature16°C, 25°C, 30°C, 37°C25°C for soluble protein
IPTG concentration0.1 mM, 0.5 mM, 1.0 mM0.5 mM
Induction time4h, 8h, 16h, overnight16h at 25°C
MediaLB, TB, 2xYT, M9+glucoseTB for highest yield

*Optimal conditions may vary based on specific experimental setup and should be determined empirically.

What strategies can be employed when SIRT2 forms inclusion bodies in E. coli?

When SIRT2 forms inclusion bodies, consider the following approaches:

  • Prevention strategies:

    • Lower the expression temperature to 16-20°C

    • Reduce inducer concentration

    • Use weaker promoters or tunable expression strains like Lemo21

    • Introduce solubility-enhancing fusion partners

  • Recovery strategies:

    • Develop an inclusion body solubilization protocol using denaturants (8M urea or 6M guanidine hydrochloride)

    • Implement a refolding strategy (dialysis, dilution, or on-column refolding)

    • Optimize buffer conditions during refolding (pH, ionic strength, additives)

  • Alternative approach:

    • Direct the protein to the periplasm using signal sequences

    • Use the Tat secretion pathway, which allows export of fully folded proteins up to 150 kDa

How can I confirm the enzymatic activity of recombinant SIRT2?

Recombinant SIRT2 activity can be assessed through various assays:

  • Deacetylation assay: The standard activity measurement is deacetylation of the Fluor de Lys® substrate. One unit of activity is defined as the amount that will deacetylate 1 pmol/min of substrate .

  • NAD-dependent activity: SIRT2 can transfer radioactivity from [32P]NAD to proteins like bovine serum albumin (BSA), which can be quantified by scintillation counting .

  • Substrate specificity assay: Using acetylated peptides derived from known SIRT2 substrates to determine kinetic parameters (Km, Vmax).

  • Inhibition studies: Testing known SIRT2 inhibitors to confirm specificity of the enzymatic activity.

What purification strategy is most effective for His-tagged SIRT2?

A robust purification strategy for His-tagged SIRT2 typically involves:

  • Cell lysis: Sonication or high-pressure homogenization in a buffer containing 25 mM Tris-HCl pH 7.5, 100 mM NaCl, and protease inhibitors.

  • Immobilized metal affinity chromatography (IMAC): Using Ni-NTA or similar resin with the following typical protocol:

    • Binding: Load clarified lysate on equilibrated column

    • Washing: Remove non-specific binding with low imidazole (10-30 mM)

    • Elution: Recover His-tagged SIRT2 with higher imidazole (250-300 mM)

  • Secondary purification: Size exclusion chromatography to remove aggregates and achieve >95% purity.

  • Final formulation: Buffer exchange to storage buffer (25 mM TRIS, pH 7.5, containing 100 mM NaCl, 5 mM DTT, and 10% glycerol) as used in commercial preparations .

Purification StepBuffer CompositionComments
Binding25 mM Tris-HCl pH 7.5, 100 mM NaClAdd 5 mM imidazole to reduce non-specific binding
Washing25 mM Tris-HCl pH 7.5, 100 mM NaCl, 20 mM imidazoleMultiple washes recommended
Elution25 mM Tris-HCl pH 7.5, 100 mM NaCl, 250 mM imidazoleCollect in fractions and analyze
Buffer Exchange25 mM Tris-HCl pH 7.5, 100 mM NaCl, 5 mM DTT, 10% glycerolFinal storage buffer

How should I design experiments to compare wild-type and mutant SIRT2 proteins?

When comparing wild-type and mutant SIRT2 proteins:

How do I analyze and present SIRT2 enzymatic activity data?

For rigorous analysis and presentation of SIRT2 activity data:

  • Data collection: Record raw activity measurements across multiple substrate concentrations and enzyme amounts.

  • Kinetic analysis: Calculate Km and Vmax using Michaelis-Menten or Lineweaver-Burk plots.

  • Data presentation: Create clear data tables containing:

    • Independent variables (e.g., substrate concentration) in the first column

    • Dependent variables (e.g., reaction rate) with appropriate units3

    • Multiple trials with calculated means and standard deviations

    • Statistical significance indicators where applicable

  • Graphical representation: Plot activity curves showing:

    • Error bars representing standard deviation or standard error

    • Trend lines with R² values

    • Clear axis labels with units

What are common issues in recombinant SIRT2 expression and how can they be resolved?

IssuePossible CausesTroubleshooting Approaches
Low expression levelsPoor codon optimization, toxicity, mRNA instabilityTry different E. coli strains (Rosetta, SixPack) , optimize codons, use lower temperature
Insoluble proteinRapid overexpression, improper foldingReduce induction temperature, decrease IPTG concentration, co-express chaperones
Poor enzymatic activityImproper folding, loss of cofactors, oxidation of cysteinesInclude DTT in buffers , ensure proper NAD+ availability, optimize purification conditions
Protein degradationProtease activity, instabilityInclude protease inhibitors, maintain cold temperature during purification, optimize buffer pH
Inconsistent batch qualityVariable expression conditionsStandardize all expression parameters, develop detailed SOPs, use internal controls

How can I monitor protein quality throughout the SIRT2 production process?

Implementing quality control checkpoints throughout the production process is crucial:

  • Post-expression: Run SDS-PAGE of total cell extracts pre- and post-induction to confirm expression.

  • Solubility check: Analyze soluble and insoluble fractions after cell lysis to assess partitioning.

  • Purification monitoring: Collect and analyze fractions from each purification step.

  • Purity assessment: Aim for >90% purity by SDS-PAGE , consider additional methods like HPLC.

  • Activity testing: Confirm specific activity after final purification using standardized assays.

  • Storage stability: Test activity retention after different storage conditions and freeze-thaw cycles.

How can recombinant SIRT2 be used to screen for novel inhibitors or activators?

Recombinant SIRT2 provides an excellent platform for compound screening:

  • High-throughput screening:

    • Utilize fluorescence-based deacetylation assays in 96 or 384-well formats

    • Develop counter-screens to eliminate false positives

    • Validate hits with orthogonal assays (e.g., radiometric assays using [32P]NAD)

  • Structure-based drug design:

    • Use purified SIRT2 for crystallization trials

    • Co-crystallize with known inhibitors or potential lead compounds

    • Perform molecular docking studies guided by structural data

  • Fragment-based screening:

    • Screen libraries of small molecular fragments

    • Use biophysical techniques (thermal shift assays, NMR) to detect binding

    • Develop fragment evolution strategies

What considerations are important when using SIRT2 for epigenetic research?

When utilizing recombinant SIRT2 for epigenetic studies:

  • Substrate specificity:

    • Test deacetylation activity against various histone and non-histone substrates

    • Design assays that reflect physiological contexts

    • Consider post-translational modifications that might influence SIRT2 activity

  • Experimental controls:

    • Use catalytically inactive mutants as negative controls

    • Include known SIRT2 inhibitors to confirm specificity

    • Verify results across multiple experimental systems

  • Physiological relevance:

    • Design experiments that bridge in vitro biochemical data with cellular functions

    • Consider the NAD+/NADH ratio as it affects sirtuin activity in vivo

    • Account for potential regulatory proteins present in cellular contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.