Recombinant Escherichia coli Protein tolQ (tolQ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tolQ; fii; b0737; JW0727; Tol-Pal system protein TolQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
tolQ
Target Protein Sequence
MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGI ELSRLYQESQGKRDNLTGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNREL ENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQAFTVSESNKG
Uniprot No.

Target Background

Function
TolQ is a component of the Tol-Pal system, crucial for outer membrane invagination during cell division and maintaining outer membrane integrity. In conjunction with TolR, it's essential for proton motive force-dependent activation of TolA and TolA-Pal interaction. The Tol-Pal system is also required for the polar localization of chemoreceptor clusters and appears necessary for the activity of several outer membrane-localized enzymes involved in cell wall remodeling. Furthermore, it participates in the uptake of group A colicins (colicins A, E1, E2, E3, and K) and filamentous phage DNA.
Database Links
Protein Families
ExbB/TolQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is TolQ and what is its role in the Tol-Pal system?

TolQ is a cytoplasmic membrane protein that serves as a critical component of the Tol-Pal system in Escherichia coli. It functions as part of a heteromultimeric complex in the cytoplasmic membrane that couples another protein, TolA, to the electrochemical gradient of the cell membrane . The Tol-Pal gene cluster consists of seven open reading frames, with five encoding proteins having established roles in the Tol system, including TolQ .

TolQ collaborates with TolR to form a membrane-bound complex that interacts with TolA, which spans the periplasmic space to connect with outer membrane-associated proteins such as TolB and Pal . This interconnected system plays a crucial role in maintaining cell envelope integrity in Gram-negative bacteria, with disruptions in TolQ function leading to cell envelope defects, including increased membrane permeability and decreased cell viability under certain conditions .

How is the TolQ protein organized structurally in bacterial membranes?

Recent structural studies have revealed that TolQ forms a pentameric arrangement in the cytoplasmic membrane, with five TolQ monomers surrounding two TolR molecules, creating a TolQ₅-TolR₂ complex . This pentameric organization is similar to the structural architecture observed in homologous systems such as ExbB-ExbD and MotA-MotB .

TolQ contains multiple transmembrane helices (TMHs) that are critical for its function. Specific glycine residues (Gly⁴⁴, Gly¹⁴⁷, and Gly¹⁵¹) located in the pore-forming TMH2 are particularly important for maintaining proper protein conformation and interactions . These residues facilitate essential main-chain polar interactions both within and between protomers. Additionally, residues such as Leu¹⁸⁵ in TMH3 contribute to the hydrophobic interface between TolQ protomers, which is critical for maintaining the stability of the pentameric complex .

What is the evidence for TolQ-FtsN interaction and its significance in cell division?

Overexpression of TolQ results in a division phenotype remarkably similar to that observed in cells depleted of FtsN, characterized by smooth, highly elongated cells . This phenotypic similarity provided the initial indication of a potential functional relationship between these proteins.

Researchers have employed bacterial two-hybrid analysis to investigate direct interactions between TolQ and FtsN. This approach involved creating fusion constructs with specific domains of both proteins: "bait" domains of TolQ (codons 1-19, 39-135, 157-174, and 194-230) were fused with λ cI protein, while "target" domains of FtsN (codons 1-33, 54-234, and 54-319) were fused with the α-subunit of RNA polymerase . These constructs allowed for detailed mapping of interaction interfaces between the two proteins.

The significance of this interaction lies in connecting the Tol system to the bacterial divisome, suggesting a previously unrecognized coordination between cell envelope integrity maintenance and cell division processes. This connection may explain why perturbations in TolQ expression can disrupt normal cell division patterns and provides new insights into the interplay between different cellular systems in bacteria .

How does the stator-rotor mechanism of TolQ-TolR compare to similar molecular systems?

The TolQ-TolR complex is believed to function as a stator-rotor system that harnesses the proton motive force (PMF) to drive essential cellular processes . This mechanism shares conceptual similarities with other bacterial molecular motors like the MotA-MotB and ExbB-ExbD systems.

In the canonical model exemplified by the MotA-MotB system, the stator components use PMF to generate torque that is applied to the rotor. While this model is well-established for flagellar rotation, the exact mechanical details of how the TolQ-TolR system converts PMF into functional work remains an active area of investigation . Molecular dynamics simulations suggest that the TolQ pentamer may rotate in harmony with TolR movements, but additional research is needed to fully characterize these complex molecular interactions .

How do specific mutations in TolQ affect its function and cellular integrity?

Point mutations in TolQ transmembrane segments can significantly alter cell envelope integrity in E. coli, resulting in ribonuclease I leakage and formation of outer membrane vesicles . Similarly, specific mutations affect membrane permeability in other Gram-negative bacteria such as Salmonella typhimurium and Erwinia chrysanthemi, increasing their sensitivity to bile salts and reducing survival rates .

Structural analysis has revealed the molecular basis for these functional defects:

  • The substitution of Ser¹⁵⁵ with glutamate introduces a long negatively charged side chain that causes van der Waals overlaps and clashes with residues in TMH3 from the same TolQ protomer

  • Mutations of glycine residues (Gly¹⁴⁴, Gly¹⁴⁷, and Gly¹⁵¹) disrupt essential main-chain polar interactions within the protein, affecting conformational flexibility of TMH2 necessary for accommodating TolR helices

  • Replacement of Leu¹⁸⁵ with cysteine introduces a sulfhydryl group that disrupts multiple nonpolar bonds, dramatically affecting the packing of the TolQ pentamer

Additionally, while deletion of tolQ is not lethal in E. coli, it causes significant phenotypic changes including reduced O7 lipopolysaccharide expression, decreased motility, and impaired colonization ability . In pathogenic bacteria like Salmonella typhimurium and Salmonella choleraesuis, TolQ deletion results in attenuated virulence .

What expression systems are most effective for recombinant TolQ production?

For recombinant expression of TolQ in E. coli, arabinose-regulated plasmid systems have proven particularly effective. Researchers have successfully used pBAD-based expression vectors (such as pBAD18-Cm) for controlled expression of TolQ . This approach offers several advantages:

  • Tight regulation of expression levels through arabinose concentration adjustment

  • Compatibility with E. coli host strains, allowing for homologous expression

  • Ability to produce sufficient protein for biochemical and structural studies

For construction of TolQ expression plasmids, researchers have employed strategies such as PCR amplification of the tolQ gene from genomic DNA (e.g., from E. coli strain W3110), followed by restriction digestion and ligation into appropriately prepared expression vectors . In specific cases, researchers have constructed plasmids carrying only tolQ (e.g., pRA031) by removing adjacent genes like tolR from existing constructs through specific restriction and ligation procedures .

When designing expression constructs, it's important to consider the transmembrane nature of TolQ and potential toxicity issues associated with its overexpression. Moderate overexpression of TolQ has been reported to hinder bacterial growth in both fluid and solid-phase cultures, requiring careful optimization of expression conditions .

What methodologies are most effective for studying TolQ-protein interactions?

Several complementary approaches have proven valuable for investigating TolQ interactions with other proteins:

  • Bacterial Two-Hybrid Analysis: This technique has been successfully employed to detect and characterize direct interactions between TolQ and divisome proteins like FtsN. The approach involves creating fusion constructs with specific domains of both proteins: "bait" domains of TolQ fused with λ cI protein, and "target" domains of the potential interaction partner fused with the α-subunit of RNA polymerase . This system allows for detailed mapping of interaction interfaces.

  • Co-immunoprecipitation Assays: These can be used to verify protein-protein interactions identified through two-hybrid screening. By using antibodies against one component (e.g., TolQ) to precipitate protein complexes from cell lysates, researchers can identify interacting partners through subsequent immunoblotting or mass spectrometry.

  • Site-Directed Mutagenesis: Creating specific mutations in TolQ transmembrane segments (such as Ser¹⁵⁵Glu, Gly¹⁴⁴Ala, Gly¹⁴⁷Ala, and Gly¹⁵¹Ala) allows researchers to evaluate the functional importance of particular residues in maintaining protein interactions and cellular integrity .

  • Structural Studies: Recent advances in cryo-electron microscopy have enabled detailed visualization of the TolQ₅-TolR₂ complex, providing insights into the structural basis of these interactions .

  • Molecular Dynamics Simulations: These computational approaches complement experimental studies by allowing researchers to investigate the dynamic behavior of protein complexes over time. Simulations of the TolQ-TolR complex have helped to assess the energy landscape and potential structural rearrangements during function .

How does overexpression of TolQ affect bacterial cell morphology and division?

Overexpression of TolQ, even at moderate levels, produces distinct phenotypic effects in E. coli. These include:

  • Growth Inhibition: TolQ overexpression hinders bacterial growth in both fluid and solid-phase cultures .

  • Cell Morphology Changes: Most notably, TolQ overexpression results in cells with a smooth, highly elongated appearance . This elongated phenotype closely resembles that observed in cells depleted of the essential cell division protein FtsN.

  • Division Defects: The elongated morphology suggests that excess TolQ interferes with normal cell division processes, potentially through its interaction with divisome components like FtsN .

These observations provide valuable insights into TolQ's potential roles beyond the canonical Tol-Pal system functions. The phenotypic similarity to FtsN-depleted cells strongly suggests that TolQ may participate in or influence cell division processes, possibly by directly interacting with division machinery components . This connection between cell envelope integrity maintenance (Tol system) and cell division (FtsN and the divisome) represents an important area for further investigation, as it may reveal new regulatory mechanisms coordinating these essential cellular processes.

What are the genetic and phenotypic consequences of TolQ deletion in different bacterial species?

While deletion of tolQ is not lethal in E. coli, it causes significant phenotypic alterations that affect various cellular functions:

Bacterial SpeciesPhenotypic Effects of TolQ Deletion
E. coliReduced O7 lipopolysaccharide expression, lower motility, deficiency in colonization
Salmonella typhimuriumDecreased virulence, increased sensitivity to bile salts
Salmonella choleraesuisAttenuated virulence
Edwardsiella ictaluridDecreased virulence

These phenotypic consequences highlight TolQ's importance in maintaining cell envelope integrity and contributing to bacterial pathogenesis. The conservation of these effects across multiple Gram-negative species underscores the fundamental role of the Tol-Pal system in bacterial physiology .

Beyond these general effects, specific point mutations in TolQ transmembrane segments can lead to more nuanced phenotypic changes. For example, mutations altering the structure of transmembrane helices can result in ribonuclease I leakage and formation of outer membrane vesicles, indicating compromised membrane integrity . Understanding these genotype-phenotype relationships provides valuable insights into TolQ's molecular function and potential applications in antimicrobial research.

What does the structural architecture of the TolQ-TolR complex reveal about its mechanism of action?

Recent structural studies have provided unprecedented insights into the TolQ-TolR complex organization:

  • Pentameric Arrangement: The complex consists of five TolQ monomers surrounding two TolR molecules (TolQ₅-TolR₂), forming a highly ordered structure in the cytoplasmic membrane . This 5:2 stoichiometry is consistent with other related systems like MotA₅-MotB₂ and ExbB₅-ExbD₂.

  • Critical Interfaces: The interface between TolQ and TolR protomers appears crucial for functional assembly of the complex. Specific residues like Ile⁴⁰, Pro²⁴, and Pro⁴¹ in TolR form important contacts with TolQ residues .

  • Transmembrane Organization: TolQ contains multiple transmembrane helices that form precise interactions both within and between protomers. TMH2 plays a particularly important role in pore formation .

Structure-guided analysis and simulations support a rotor-stator mechanism of action, wherein the rotation of the TolQ pentamer harmonizes with TolR movements . In this model, the transmembrane portions of the structure maintain their shape during simulations, with energy landscapes calculated from the simulations appearing mostly flat, indicating minimal structural rearrangements in microsecond-long molecular dynamics simulations .

Interestingly, researchers did not observe any translational or rotational movement of the TolR monomers with respect to each other during simulations. They also did not detect rotational movement of the TolR monomers with respect to the TolQ pentamer within the simulation timescale . These observations suggest that larger conformational changes might occur on longer timescales or under specific conditions not captured in the current simulations.

How can researchers optimize structural studies of the TolQ-TolR complex?

For researchers pursuing structural investigations of the TolQ-TolR complex, several optimization strategies should be considered:

  • Expression and Purification: Given the transmembrane nature of both TolQ and TolR, detergent selection is critical for maintaining protein stability and native conformation during purification. Mild detergents that preserve membrane protein structure should be evaluated systematically.

  • Cryo-EM Sample Preparation: Recent successful structural determination of the TolQ₅-TolR₂ complex demonstrates the power of cryo-electron microscopy for membrane protein complexes . Optimization of grid preparation, including detergent concentration, protein concentration, and vitrification conditions, is essential for high-resolution structure determination.

  • Mutagenesis Approach: Strategic mutations can help validate structural models and provide insights into functional mechanisms. Based on available structures, researchers can target specific residues such as Gly¹⁴⁴, Gly¹⁴⁷, and Gly¹⁵¹ in TolQ's TMH2, which are critical for maintaining proper protein conformation and interactions .

  • Complementary Techniques: While cryo-EM has provided valuable insights, complementary approaches such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) could offer additional information about protein dynamics and solvent accessibility.

  • Computational Analysis: Molecular dynamics simulations have proven valuable for investigating the dynamic behavior of the TolQ-TolR complex . Extending simulation timescales and applying enhanced sampling techniques could reveal conformational changes not captured in standard simulations.

What are the most promising avenues for future TolQ research?

Several promising research directions emerge from current understanding of TolQ:

  • Detailed Mechanism of PMF Utilization: While the TolQ-TolR complex is believed to harness proton motive force, the precise mechanism by which proton translocation is coupled to conformational changes remains to be fully elucidated. Identifying specific residues involved in proton translocation would significantly advance our understanding.

  • Regulatory Networks: Further investigation into how TolQ expression and function are regulated in response to environmental changes and stress conditions could reveal new aspects of bacterial adaptation mechanisms.

  • TolQ-FtsN Interaction: The connection between TolQ and the cell division protein FtsN represents an exciting area for further research . Exploring how this interaction coordinates cell envelope integrity with division processes could provide insights into fundamental bacterial cell biology.

  • Comparative Analysis Across Species: While most research has focused on E. coli TolQ, comparative studies across different bacterial species could illuminate evolutionary adaptations and species-specific functions of this protein .

  • Therapeutic Targeting: Given TolQ's importance for cell envelope integrity and virulence in multiple pathogenic bacteria , exploring it as a potential antimicrobial target represents a promising avenue for addressing antibiotic resistance challenges.

How might understanding TolQ function contribute to antimicrobial strategies?

The critical role of TolQ in maintaining cell envelope integrity and contributing to virulence in multiple pathogenic bacteria makes it a promising target for novel antimicrobial strategies:

  • Envelope Integrity Disruption: Compounds that specifically interfere with TolQ function could compromise bacterial cell envelope integrity, potentially increasing susceptibility to existing antibiotics or directly causing bacterial cell death.

  • Virulence Attenuation: Since TolQ deletion reduces virulence in multiple pathogenic species , targeting this protein could lead to attenuated infections that are more easily cleared by host immune responses.

  • Combination Therapies: Inhibitors targeting TolQ could be particularly effective in combination with existing antibiotics, especially those whose efficacy is limited by the outer membrane barrier in Gram-negative bacteria.

  • Structure-Based Drug Design: The recently determined structure of the TolQ₅-TolR₂ complex provides a valuable foundation for structure-based drug design approaches targeting specific interaction interfaces or functional domains.

  • Species-Specific Targeting: Comparative analysis of TolQ across different bacterial species might reveal structural or functional differences that could be exploited for developing narrow-spectrum antimicrobials, reducing disruption to beneficial microbiota.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.