Recombinant Escherichia coli Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own applications.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
secD; b0408; JW0398; Protein translocase subunit SecD; Sec translocon accessory complex subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-615
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
secD
Target Protein Sequence
MLNRYPLWKYVMLIVVIVIGLLYALPNLFGEDPAVQITGARGVAASEQTLIQVQKTLQEE KITAKSVALEEGAILARFDSTDTQLRAREALMGVMGDKYVVALNLAPATPRWLAAIHAEP MKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGIPYTTVRKENNYGLSITF RDAKARDEAIAYLSKRHPDLVISSQGSNQLRAVMSDARLSEAREYAVQQNINILRNRVNQ LGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEFRLVNTNVDQAAAASGRVPG DSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQVNISLDSAGGNIMSNFTKDN IGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQSRLGNSFRITGINNPNEARQL SLLLRAGALIAPIQIVEERTIGPTLGMQNIEQGLEACLAGLLVSILFMIIFYKKFGLIAT SALIANLILIVGIMSLLPGATLSMPGIAGIVLTLAVAVDANVLINERIKEELSNGRTVQQ AIDEGYRGAFSSIFDANITTLIKVIILYAVGTGAIKGFAITTGIGVATSMFTAIVGTRAI VNLLYGGKRVKKLSI
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA. The large periplasmic domain is believed to have a base and head domain connected by a hinge. Movement of the hinge may be coupled to both proton transport and protein export, with the head domain capturing substrate, and a conformational change preventing backward movement and driving forward movement. Expression of Vibrio alginolyticus SecD and SecF in Escherichia coli confers Na(+)-dependent protein export, strongly suggesting that SecDF functions via cation-coupled protein translocation.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of SecD in the E. coli protein translocation machinery?

SecD functions as a peripheral subunit of the Sec translocase complex, working alongside the core SecYEG channel to facilitate efficient protein translocation across the bacterial cytoplasmic membrane. While not part of the essential channel-forming complex, SecD contributes to the maintenance of proton motive force utilization during translocation and helps prevent backsliding of translocating polypeptides. The protein works in coordination with other Sec components, particularly the SecA ATPase which drives the transmembrane movement of preproteins through cycles of ATP binding and hydrolysis .

SecD is part of E. coli's adaptive response to protein translocation needs. When E. coli experiences increased demand for protein translocation, it can modulate its translocation machinery capacity, including the levels of several key players like SecA, LepB, and YidC . While SecD is not specifically mentioned in the provided studies as being upregulated, its function within the larger translocation machinery suggests it may be part of this adaptive response system.

How does SecD interact with other components of the Sec machinery?

SecD operates as part of an auxiliary complex (often with SecF) that associates with the core SecYEG channel. The functional interaction involves:

  • Proton motive force coupling: SecD helps couple the proton motive force to protein translocation

  • Preventing substrate backsliding: SecD likely acts as a ratchet to prevent backward movement of translocating polypeptides

  • SecA cycle modulation: SecD may influence the ATP-dependent cycling of the SecA motor protein during translocation events

These interactions are dynamic, with the SecA ATPase engaging and disengaging with the SecYEG components during protein translocation cycles . The Sec translocase forms part of a larger network interacting with other cellular components to achieve efficient protein translocation across the bacterial cytoplasmic membrane.

What expression systems are commonly used for recombinant SecD production?

For recombinant production of SecD and other Sec pathway components, tunable expression systems like the rhamnose promoter-based setup have shown considerable advantages. These systems allow researchers to harmonize the production rate of secretory recombinant proteins with the Sec-translocon capacity .

Recommended expression systems for membrane proteins like SecD:

Expression SystemAdvantagesConsiderations
Rhamnose promoter-basedTunable expression; allows E. coli to adapt its translocation machineryProvides mild protein secretion stress that cells can adapt to
T7 promoter-basedHigh expression levelsMay cause stress leading to the accumulation of mutations

When designing expression systems for SecD or other Sec components, it's essential to consider that strong promoters like T7 can cause significant stress, leading to adaptive mutations, while tunable systems allow for physiological adaptation of the translocation machinery without mutations .

How should experimental designs be optimized for studying SecD expression and function?

When studying SecD expression and function, a multivariant experimental design approach is significantly more effective than traditional univariant methods. This approach allows you to:

  • Evaluate statistical significance of multiple variables simultaneously

  • Account for interactions between variables

  • Characterize experimental error effectively

  • Compare effects of normalized variables

  • Gather high-quality data with fewer experiments

Recommended multivariant approach:

  • Use factorial designs to optimize culture conditions

  • Employ statistical techniques for designing experiments

  • Build models to evaluate the effects of variables

  • Search for optimum conditions systematically

This methodology has been successfully used to optimize many bioprocesses and is particularly valuable for heterologous protein expression studies . For SecD specifically, this approach can help identify optimal conditions for expression while maintaining proper membrane integration and function.

When expression level is a critical factor, consider that "when the recombinant protein is expressed intracellularly in host cells, it is known that to yield high amounts of that protein, it is necessary to achieve high cell growth. Thus, the higher the cell growth, the more recombinant protein is synthesized" .

What strategies can be employed to enhance SecD solubility during recombinant expression?

  • Experimental design optimization:

    • Use statistical experimental design methodology to systematically evaluate variables affecting expression

    • Consider temperature, inducer concentration, media composition, and induction timing

    • Analyze interactions between variables rather than testing one variable at a time

  • Expression system selection:

    • Employ tunable promoters (like rhamnose-based systems) rather than strong constitutive promoters

    • This approach has shown success with other components of the Sec machinery

  • Fusion partners and solubility tags:

    • For studies requiring soluble domains, consider fusion with solubility-enhancing partners

    • Test multiple fusion configurations to identify optimal construct design

  • Buffer and additive screening:

    • Systematically test buffer compositions that maintain structural integrity

    • Explore stabilizing agents specific to membrane proteins

One successful approach reported for a different protein achieved high levels (250 mg/L) of soluble expression using experimental design methodology, which could be adapted for SecD studies .

How can researchers effectively analyze the impact of SecD mutations on protein translocation efficiency?

To effectively analyze the impact of SecD mutations on protein translocation efficiency, researchers should implement a comprehensive experimental approach:

  • Mutation design strategy:

    • Target conserved residues identified through comparative genomics

    • Focus on domains predicted to interact with other Sec components

    • Create a library of point mutations, deletions, and chimeric constructs

  • Translocation assay selection:

    • In vivo: Monitor secretion of reporter proteins in strains expressing mutant SecD

    • In vitro: Reconstitute translocation systems with purified components including mutant SecD

    • Compare efficiency using quantitative readouts (e.g., enzymatic activity of translocated proteins)

  • Interaction analysis:

    • Assess how mutations affect interactions with SecYEG and SecA

    • Employ techniques such as co-immunoprecipitation, FRET, or crosslinking

    • Correlate interaction changes with translocation efficiency

  • Structural analysis:

    • Determine how mutations affect SecD structure using techniques like CD spectroscopy or limited proteolysis

    • For significant mutations, pursue structural studies when feasible

  • Data analysis framework:

    • Implement statistical methods to assess significance of observed effects

    • Use multivariate analysis to identify patterns across multiple mutations

    • Consider developing predictive models based on collective mutation data

What are the best approaches for secondary data analysis when studying SecD function across different bacterial species?

When conducting secondary data analysis (SDA) on SecD function across bacterial species, researchers should follow these methodological guidelines:

  • Begin with clear research questions:

    • Start with specific hypotheses about SecD function

    • Alternatively, examine available datasets to identify potential questions

    • Be prepared to modify research questions based on available data

  • Dataset selection criteria:

    • Evaluate dataset fit to research questions

    • Assess internal and external validity

    • Consider dataset age and relevance to current knowledge

    • Ensure adequate sample sizes for meaningful statistical analysis

  • Comprehensive understanding of dataset limitations:

    • Obtain detailed descriptions of methodologies

    • Study all available documentation (codebooks, guidebooks)

    • Assess quality control measures

    • Evaluate response levels and potential biases

  • Analysis plan development:

    • Specify variables and analyses before examining data (question-driven approach)

    • Or determine variables after exploratory data examination (data-driven approach)

    • Document adaptations made due to dataset constraints

  • Cross-species comparison framework:

    • Normalize data across different species

    • Account for phylogenetic relationships

    • Consider evolutionary conservation of SecD domains

When reporting SDA research on SecD, ensure you address:

  • Logical justification for study importance

  • Clear research questions and operational definitions

  • Acknowledgment of original data sources and ethical approvals

  • Discussion of dataset strengths and weaknesses

  • Assessment of how well data fits research questions

This approach maximizes the benefits of SDA, including economic savings in time and resources while avoiding data collection challenges .

How should researchers interpret changes in SecD expression levels in response to secretory stress?

When interpreting changes in SecD expression levels in response to secretory stress, researchers should consider the following analytical framework:

  • Context within the adaptive response network:

    • E. coli can adapt its protein translocation machinery in response to secretory stress

    • Changes in SecD should be evaluated alongside other Sec components (SecA, LepB, YidC)

    • Consider the reversibility of changes, which suggests regulatory mechanisms rather than mutations

  • Promoter system influence:

    • The promoter system governing recombinant protein expression affects how E. coli responds to production stress

    • Strong promoters like T7 can lead to stress-alleviating mutations

    • Tunable systems like rhamnose promoters may induce adaptive responses without mutations

  • Relationship to secretion monitors:

    • Consider the role of secretion monitors like SecM in regulation

    • Insufficient Sec-translocon capacity upon secretory protein production can trigger increased synthesis of components like SecA

    • Determine whether SecD regulation follows similar patterns

  • Signal peptide dependence:

    • Different signal peptides elicit different adaptive responses

    • For example, PhoA signal peptide usage results in different patterns of component upregulation compared to other signal peptides

    • Analyze how different signal peptides affect SecD expression specifically

  • Quantitative analytical approaches:

    • Use multivariate analysis to assess relationships between expression levels of different components

    • Employ time-course analysis to evaluate adaptation dynamics

    • Consider mathematical modeling to predict system behavior

This interpretive framework acknowledges that "E. coli has, besides the secretion monitor SecM, also other mechanisms enabling it to adapt its protein translocation capacity to its protein translocation needs" .

What statistical methods are most appropriate for analyzing SecD function in reconstituted systems?

When analyzing SecD function in reconstituted systems, selecting appropriate statistical methods is crucial for robust and reproducible results:

  • Experimental design considerations:

    • Employ factorial designs to evaluate multiple variables simultaneously

    • This approach allows identification of significant effects, building models, and evaluating interactions between variables

    • Particularly valuable when optimizing reconstitution conditions for SecD function

  • Recommended statistical approaches:

    Analysis TypeAppropriate MethodsApplication in SecD Studies
    Kinetic measurementsNon-linear regression, Michaelis-Menten analysisAnalyzing translocation rates with purified components
    Comparative studiesANOVA with post-hoc testsComparing SecD variants or conditions
    Correlation analysisMultiple regression, path analysisRelating SecD activity to other components
    System optimizationResponse surface methodologyIdentifying optimal reconstitution conditions
    Interaction studiesPrincipal component analysisAnalyzing complex datasets with multiple variables
  • Sample size determination:

    • Conduct power analysis to determine appropriate sample sizes

    • Consider biological and technical replicates separately

    • For reconstituted systems, technical variability often exceeds biological variability

  • Data transformation considerations:

    • Assess normality and homogeneity of variance

    • Apply appropriate transformations when necessary

    • For kinetic data, log transformations may be appropriate

  • Validation approaches:

    • Use cross-validation methods to confirm robustness

    • Employ bootstrapping for small sample sizes

    • Consider Bayesian approaches for complex models

Implementing these statistical methods ensures that "the experimental design methodology allow[s] the development of an adequate process condition" for studying SecD function in reconstituted systems .

How can researchers troubleshoot poor expression or functionality of recombinant SecD?

When encountering challenges with recombinant SecD expression or functionality, implement this systematic troubleshooting approach:

  • Expression system evaluation:

    • Assess promoter strength and inducibility

    • Consider that tunable promoter systems (like rhamnose-based) may be preferable to strong constitutive promoters like T7

    • Strong promoters can cause stress leading to mutations that affect expression

  • Signal sequence optimization:

    • Test multiple signal peptides, as different signal sequences significantly impact translocation efficiency

    • Different signal peptides trigger different adaptive responses in the Sec machinery

    • Document SecD expression levels when using different signal peptides

  • Host strain considerations:

    • Evaluate SecD expression in strains with different protein translocation capacities

    • Consider that overexpression may be toxic to cells with limited translocation capacity

    • Test strains with mutations in endogenous secD to minimize competition

  • Solubilization and purification optimization:

    • Systematically test detergent types and concentrations

    • Evaluate buffer compositions for optimal stability

    • Consider native-state purification approaches

  • Functionality assessment:

    • Implement multiple complementary assays to evaluate SecD function

    • Compare in vivo complementation with in vitro activity

    • Establish clear quantitative benchmarks for function

  • Experimental design approach:

    • Apply multivariant analysis rather than changing one variable at a time

    • This approach allows estimation of statistically significant variables while accounting for interactions

    • Use factorial designs to systematically optimize conditions

This comprehensive troubleshooting strategy recognizes that "to harmonize the production rate of a secretory recombinant protein with the Sec-translocon capacity, a tunable protein production system should be used" .

What are the critical quality control checkpoints for assessing purified recombinant SecD?

To ensure high-quality purified recombinant SecD preparations, researchers should implement these critical quality control checkpoints:

  • Purity assessment:

    • SDS-PAGE analysis with densitometry quantification

    • Target minimum 75% homogeneity for functional studies

    • Mass spectrometry identification of major contaminants

  • Structural integrity evaluation:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Limited proteolysis to assess domain folding

    • Size-exclusion chromatography to evaluate oligomeric state

  • Membrane integration analysis:

    • Detergent exchange compatibility

    • Reconstitution efficiency into liposomes

    • Orientation assessment in membrane mimetics

  • Functional activity verification:

    • ATPase stimulation assays with SecA

    • Interaction studies with other Sec components

    • Reconstituted translocation assays with model substrates

  • Stability monitoring:

    • Thermal stability profiles

    • Time-course activity retention

    • Freeze-thaw cycle tolerance

    Quality ParameterAcceptance CriteriaRecommended Methods
    Purity≥75%SDS-PAGE, SEC-MALS
    IdentityConfirmed sequenceMass spectrometry
    Structural integrityNative-like secondary structureCD spectroscopy
    HomogeneitySingle species dominanceSEC, DLS
    Functional activityStatistically significant activity above backgroundReconstituted assays

When designing quality control protocols, remember that the experimental approach should allow "the development of an adequate process condition to attain high levels of soluble expression of functional [protein] in E. coli, which should contribute to reduce operational costs" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.