Recombinant Escherichia coli Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Introduction to Protein Translocase Subunit SecF

The SecF protein is an integral membrane component of the bacterial protein translocation machinery, functioning as an auxiliary subunit of the Sec protein translocase complex. In Escherichia coli, particularly in the K12 strain, SecF consists of 323 amino acids and forms part of the SecYEG-SecDF-YajC-YidC holotranslocon (HTL), a sophisticated multiprotein complex required for protein secretion and insertion into membranes . This complex represents one of the most fundamental protein transport systems in bacteria, responsible for moving newly synthesized proteins from the cytoplasm to their final destinations in the cell envelope.

SecF works in cooperation with SecD to utilize the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA, the motor protein of the complex . Together, SecD and SecF form the SecDF complex, which plays a critical role in the efficient export of proteins across the bacterial cytoplasmic membrane.

Evolutionary Conservation and Structure

SecF is a prokaryote-specific protein that operates within the bacterial secretion system. Unlike eukaryotic cells, which employ different machinery for protein translocation, bacteria rely on the Sec system for the majority of their protein export requirements. The periplasmic domain of SecDF consists of three distinct regions: the P1-head and P1-base (which are part of SecD), and the P4 domain (which belongs to SecF) . Mutagenesis studies have demonstrated that the P1-head domain is particularly crucial for the translocation process .

General Properties of SecF

SecF is a membrane-spanning protein with transmembrane helices that anchor it within the cytoplasmic membrane. Its large periplasmic domain features a base and head domain connected by a hinge, the movement of which may be coupled to both proton transport and protein export . This dynamic structure allows the head domain to capture substrate proteins, while conformational changes prevent backward movement and drive forward translocation.

Three-dimensional Structure

SecDF adopts three distinct conformational forms that vary primarily with the conformation of the P1 domain: the super membrane facing (super F), membrane facing (F), and intermediate (I) forms . These structural transitions are directly related to SecDF function and are likely driven by proton transport through the transmembrane domain.

The transmembrane (TM) region of SecDF consists of 12 helices, with TM1–6 and TM7–12 corresponding to SecD and SecF, respectively. While the super-F and F forms of SecDF show a sealed TM region, analysis of I form structures has revealed a channel comprising TM4, TM5, TM6, and TM10 that provides a continuous pathway from the cytoplasm to the periplasm .

Functional Mechanisms of SecF in Protein Translocation

SecF plays a crucial role in the bacterial protein export pathway, particularly in the later stages of translocation after the initial ATP-dependent steps mediated by SecA.

Role in the Sec Translocase System

The Sec translocase system in E. coli operates via two primary pathways: co-translational and post-translational. In the post-translational pathway, secretory proteins with less hydrophobic signal sequences are bound by chaperones that keep them in an unfolded state suitable for translocation . SecA functions as an ATP-dependent motor protein that drives the stepwise translocation of preproteins across the SecYEG channel, while the adjoining SecDF complex supports later stages of translocation .

SecF, together with SecD, uses the proton motive force to enhance the efficiency of translocation and potentially pull translocating proteins from the channel at the periplasmic side of the membrane . This function is particularly important for the complete translocation of certain preproteins that might otherwise remain partially trapped in the translocon.

Interaction with Other Sec Proteins

SecF interacts with multiple components of the Sec machinery, forming a functional network that enables efficient protein translocation. Table 1 summarizes these key interactions based on experimental evidence.

Table 1: Functional Interactions of SecF with Other Sec Proteins

Interacting ProteinInteraction TypeFunctional SignificanceReference
SecDDirect complex formationForms the SecDF complex crucial for protein translocation
SecYStabilizationSecF overproduction enhances SecY levels
YajCComplex formationForms part of the SecDF-YajC subcomplex
YidCPhysical proximityClose contacts in the holotranslocon structure
SecAFunctional interactionSecDF stabilizes the inserted form of SecA
SecE, SecGFunctional integrationPart of the preprotein translocase holoenzyme

These interactions highlight the central role of SecF in the complex network of proteins that constitute the bacterial protein translocation machinery. The STRING protein interaction database reports high confidence scores (0.999) for SecF's interactions with YajC, SecD, SecG, SecY, YidC, and SecE, emphasizing the strong functional relationship between these proteins .

Proton Motive Force Utilization

A distinctive feature of SecDF is its ability to harness the proton motive force to energize protein translocation. All-atom molecular dynamics simulations have revealed that a highly conserved aspartate residue (Asp365) within transmembrane helix 5 is likely involved in channel formation and proton transport . The deprotonated state of this residue appears to attract water molecules from the cytoplasmic side of the membrane, potentially initiating the formation of a proton conduction pathway.

Interestingly, the distance between the proton-interacting transmembrane region and the presumed precursor interaction area in the periplasmic region is large, suggesting a mechanism of long-range allosteric control . Changes in the transmembrane region can produce dramatic structural changes in the periplasmic domain, including the conversion of a β-sheet (present in both the F and I forms) to a β-barrel (super F form) .

Recombinant Production of E. coli SecF

The production of recombinant SecF has been valuable for structural and functional studies of the protein translocation machinery. Various expression systems and purification strategies have been developed to obtain pure, functional SecF protein for research applications.

Expression Systems and Production Methods

Recombinant E. coli SecF is typically produced using bacterial expression systems, where the secF gene from E. coli strain K12 is cloned into expression vectors with suitable promoters and affinity tags for purification. Common approaches include the use of His-tagged constructs expressed in E. coli host strains . Table 2 provides details on available recombinant SecF preparations.

Table 2: Recombinant E. coli SecF Protein Preparations

Product DescriptionTagExpression HostSize (aa)ApplicationsReference
Full-length SecF (1-323)N-terminal HisE. coli323SDS-PAGE, functional studies
SecF (strain K12)VariousE. coli or Yeast or Baculovirus or Mammalian Cell323Vaccine development research
SecYEG-SecDF-YajC-YidC holotransloconComplex purificationE. coliMultiple subunitsStructural and functional studies

The ACEMBL system has been used to create balanced overexpression of recombinant multiprotein complexes including the SecYEG-SecDF-YajC-YidC holotranslocon (HTL) . This modular approach allows for the design of monocistronic or polycistronic DNA constructs, facilitating the expression and purification of functional HTL and its association with translating ribosome nascent chain (RNC) complexes .

Purification Strategies

Purification of recombinant SecF typically involves affinity chromatography using the attached tags (such as His-tags), followed by additional purification steps including size exclusion chromatography or ion exchange chromatography. Due to its membrane protein nature, detergents or lipid nanodiscs are often used to maintain SecF solubility and functionality during purification .

For reconstitution studies, purified SecF is often co-purified with other components of the Sec system, particularly SecD, to form the functional SecDF complex. This approach has been essential for structural studies of the complete translocon .

Quality Assessment of Recombinant SecF

Recombinant SecF quality is typically assessed using SDS-PAGE to confirm size and purity, with greater than 90% purity achievable using optimized purification protocols . Functional assays may include reconstitution with other Sec components to assess protein translocation activity in vitro.

The recombinant protein is generally supplied in buffer conditions that maintain stability, such as Tris/PBS-based buffers with trehalose at pH 8.0, and may be lyophilized for long-term storage . For experimental use, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with the addition of glycerol (5-50%) for aliquoting and long-term storage at -20°C/-80°C .

Genetic Studies and Physiological Role of SecF

Genetic studies have provided significant insights into the physiological importance of SecF in bacterial cells, particularly through the analysis of mutants and overexpression phenotypes.

Phenotypes of secF Mutants

Deletion of the secF gene results in severe physiological consequences for E. coli cells. A secF null mutant displays phenotypes identical to those of a secD null mutant or a secDF double null mutant . Table 3 summarizes the key phenotypes associated with secF mutations.

Table 3: Phenotypes of secF Mutants in E. coli

Mutation TypeGrowth PhenotypeProtein Export PhenotypeOther ObservationsReference
secF nullCold-sensitive for growthSevere export defect at 37°CBarely viable
secDF::kan double nullCold-sensitive for growthSevere export defect at 37°CBarely viable
secF depletionReduced growthGreatly reduced protein translocationNot abolished completely

These phenotypes indicate that while SecF is not absolutely essential for viability under optimal conditions, it plays a critical role in efficient protein export, particularly at lower temperatures. The cold-sensitive nature of secF mutations suggests that an early step in protein export is particularly vulnerable to cold temperatures .

Overexpression Studies

Overexpression of SecF has revealed interesting effects on other components of the Sec machinery. Studies have shown that SecF overproduction results in the simultaneous overproduction of SecD encoded by the tac-secD gene on a plasmid . This effect was determined to be due to stabilization of SecD by SecF, as demonstrated by pulse-chase experiments .

Additionally, SecF overproduction enhances the levels of SecY, both when SecY is expressed from a plasmid and when it is expressed from the chromosomal secY gene . This effect is specific and not mediated through SecD or SecE, as SecF overproduction did not affect the levels of SecD and SecE expressed by their respective chromosomal genes .

These findings suggest that SecF directly interacts with both SecD and SecY, stabilizing these proteins and potentially facilitating the assembly of the complete Sec translocase complex. The enhanced stability of these components likely contributes to the improved protein export observed when SecF is overexpressed.

Role in Protein Export Efficiency

Overexpression of SecD and SecF stimulates protein translocation in wild-type cells and improves the export of proteins with mutant signal sequences . This enhancement of protein export efficiency highlights the role of SecDF as a "translocation enhancer" rather than an essential component of the core translocation machinery.

The SecDF complex appears to have a unique function that is fundamentally different from other Sec proteins. While the core SecYE complex is sufficient to activate SecA as a preprotein-dependent ATPase and provide sites for SecA binding and insertion, efficient preprotein translocation and SecA membrane cycling also require the functions of either SecG or the SecDFyajC complex .

Functional Mechanism and Applications of Recombinant SecF

Understanding the molecular mechanisms of SecF function has important implications for both basic science and applied biotechnology.

Research Applications of Recombinant SecF

Recombinant SecF has various applications in research settings, as outlined in Table 4.

Table 4: Research Applications of Recombinant E. coli SecF

Application AreaSpecific UseBenefitReference
Structural biologyReconstitution of Sec complexesUnderstanding translocon architecture
Functional studiesIn vitro translocation assaysElucidating mechanism of protein transport
Interaction studiesIdentifying protein-protein interactionsMapping the translocon interactome
Vaccine developmentResearch on recombinant protein productionPotential vaccine component research
BiotechnologyEnhanced protein secretionImproved yields of secreted recombinant proteins

One particularly interesting application relates to the finding that modified recombinant proteins can be exported via the Sec pathway in E. coli . This challenges the common assumption that the Sec pathway, which transports preproteins in an unfolded state, is unfavorable for modification of proteins in the cytosol. The demonstration that posttranslationally modified fusion proteins can be accommodated by the Sec machinery provides an alternative approach to achieve high levels of modified recombinant proteins expressed extracellularly .

Future Research Directions

Several important questions about SecF function remain to be fully addressed. These include understanding the dynamics of translocase subunit associations, how SecDFyajC stabilizes SecA insertion and thus the movement of preproteins, and which subunits directly contact the preprotein and SecA during translocation .

Recent advances in cryo-electron microscopy and other structural biology techniques have provided new insights into the architecture of the holotranslocon, including the positioning and interactions of SecF . Continued research in this area promises to further elucidate the complex mechanisms underlying bacterial protein secretion and membrane protein insertion.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please specify your preferred format during order placement.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, centrifuge the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Minimize repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a particular tag preference, please inform us, and we will prioritize the development of your desired tag.
Synonyms
secF; b0409; JW0399; Protein translocase subunit SecF; Sec translocon accessory complex subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-323
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
secF
Target Protein Sequence
MAQEYTVEQLNHGRKVYDFMRWDYWAFGISGLLLIAAIVIMGVRGFNWGLDFTGGTVIEI TLEKPAEIDVMRDALQKAGFEEPMLQNFGSSHDIMVRMPPAEGETGGQVLGSQVLKVINE STNQNAAVKRIEFVGPSVGADLAQTGAMALMAALLSILVYVGFRFEWRLAAGVVIALAHD VIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIRENFRKIRRGTPYEIFNVS LTQTLHRTLITSGTTLMVILMLYLFGGPVLEGFSLTMLIGVSIGTASSIYVASALALKLG MKREHMLQQKVEKEGADQPSILP
Uniprot No.

Target Background

Function
SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA. The large periplasmic domain is believed to possess a base and head domain connected by a hinge. Movement of the hinge may be linked to both proton transport and protein export, with the head domain capturing substrate, preventing backward movement, and driving forward translocation. Expression of V.alginolyticus SecD and SecF in E.coli confers Na(+)-dependent protein export, strongly suggesting that SecDF functions via cation-coupled protein translocation.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of SecF in the E. coli protein translocation machinery?

SecF is a membrane protein component of the bacterial Sec-translocon, which mediates the translocation of secretory proteins across the cytoplasmic membrane as well as the insertion of membrane proteins into the cytoplasmic membrane. While the core of the Sec-translocon consists of SecY and SecE (which together form a protein-conducting channel) and the peripheral ATP-dependent motor protein SecA, SecF plays an important auxiliary role in the complex .

SecF functions in conjunction with other accessory components to enhance translocation efficiency. Unlike the motor protein SecA, which actively pushes secretory proteins through the SecYE channel using ATP hydrolysis, SecF is believed to help maintain the translocating protein in the proper orientation and prevent its backsliding during the translocation process .

How does SecF interact with other components of the Sec-translocon?

SecF interacts closely with several components of the Sec-translocon machinery:

  • SecY/SecE: SecF associates with the central channel components to stabilize the translocation complex

  • SecD: SecF typically forms a complex with SecD (the SecDF complex)

  • YidC: The membrane protein integrase/chaperone YidC can work with SecF during membrane protein insertion

  • SecA: While not directly binding, SecF functionally complements SecA's motor activity

These interactions create a dynamic network that facilitates efficient protein translocation. The cytoplasmic membrane protein YidC can assist the biogenesis of membrane proteins both in conjunction with the Sec-translocon and as an independent entity, suggesting flexibility in how these components associate during different translocation events .

What experimental systems are commonly used to study recombinant SecF in E. coli?

For studying recombinant SecF and other Sec-translocon components in E. coli, researchers typically employ several experimental approaches:

  • Tunable expression systems: Rhamnose promoter-based expression vectors combined with strains deficient in the rhamnose operon enable precise regulation of protein production rates by varying rhamnose concentration in culture media .

  • Periplasmic protein production assays: These systems measure the efficiency of protein translocation across the cytoplasmic membrane, often using reporter proteins like human Growth Hormone (hGH) .

  • Signal peptide selection: Various signal peptides can be fused to target proteins to direct them to the Sec-translocon, allowing researchers to study how SecF participates in different targeting pathways .

  • Proteomics analysis: Mass spectrometry-based approaches can determine how SecF and other translocation components change in abundance under different conditions .

As noted in recent studies: "To harmonize the production rate of a secretory recombinant protein with the Sec-translocon capacity, a tunable protein production system should be used" .

How can experimental design principles be applied to investigate SecF function in protein translocation?

When designing experiments to investigate SecF function, researchers should follow these methodological approaches:

  • Establish initial equivalence of experimental groups

    • Random assignment of experimental units to treatment conditions is crucial for valid causal inferences

    • In independent-groups or between-participants designs, subjects are randomly and independently assigned to each level of the independent variable

  • Apply appropriate experimental control strategies

    • Use completely randomized groups design when studying one independent variable with two or more levels

    • Consider how sample size, assignment of experimental units, and selection of treatment factor combinations will affect variance and bias of estimates

  • Connect research objectives to design type

    • Focus on "constructing the design (including performing proper randomization and determining the required number of replicates)"

    • "Execute the plan to collect the data (or advise a colleague on how to do it)"

    • "Determine the model appropriate for the data"

  • Data analysis selection

    • Choose analytical methods based on the experimental design used

    • Consider whether data tables (one-way or two-way) are appropriate for scenario analyses

What adaptation mechanisms does E. coli employ to regulate SecF and other components of the protein translocation machinery?

Research has revealed that E. coli can adapt its protein translocation machinery in response to secretory stress:

"E. coli adapts for enhanced periplasmic recombinant protein production through regulatory mechanisms rather than through the accumulation of mutations" .

This adaptation involves several coordinated responses:

  • SecA upregulation mechanism

    • The SecA-dependent secretion monitor SecM is involved in secretion-responsive control of SecA translation

    • "Inefficient translocation of SecM to the periplasm via the Sec-translocon results in the increased synthesis of SecA in order to relieve the protein translocation stress"

  • Coordinated component regulation

    • When using signal peptides like DsbA for periplasmic protein production, accumulation levels of SecA, LepB, and YidC all increase

    • With other signal peptides like PhoA, only SecA and LepB increase, suggesting pathway-specific adaptation mechanisms

  • Reversible adaptation

    • Interestingly, these changes in protein levels are reversible, indicating regulatory control rather than genetic mutations

This adaptability indicates that "E. coli has, besides the secretion monitor SecM, also other mechanisms enabling it to adapt its protein translocation capacity to its protein translocation needs" .

How do signal peptides affect SecF functionality in recombinant protein production systems?

Signal peptides play a crucial role in directing proteins to the Sec-translocon and can significantly impact SecF functionality:

  • Signal peptide characteristics and targeting pathways

    • Signal peptides can direct proteins either co-translationally via the Signal Recognition Particle (SRP)-pathway or post-translationally in a chaperone-dependent or -independent manner

    • "The mode of translocation through the Sec-translocon can affect how a protein folds in the periplasm"

  • Hydrophobicity effects on targeting

    • "Targeting of an export-defective protein can be rescued by increasing the hydrophobicity of the h-region"

    • "By funneling the protein into the co-translational SRP-pathway the premature folding of the protein in the cytoplasm is most likely prevented"

  • Signal peptide influence on translocation machinery components

    • Different signal peptides trigger different adaptations in the Sec machinery:

    • When DsbA signal peptide is used, SecA, LepB, and YidC levels all increase

    • With PhoA signal peptide, only SecA and LepB levels increase, and to a lesser extent

The data suggests signal peptide selection is a critical parameter in experimental design for studying SecF function, as summarized in the table below:

Signal PeptideTargeting PathwayEffect on SecF SystemProtein Folding Impact
DsbACo-translationalIncreases SecA, LepB, and YidC levelsEnhanced periplasmic folding
PhoAPost-translationalModerate increase in SecA and LepB onlyLower periplasmic yields
OthersVariablePathway-specific adaptationsDependent on translocation efficiency

What methodological approaches can resolve contradictions in SecF functional studies?

When researchers encounter contradictory data regarding SecF function, several methodological approaches can help resolve these discrepancies:

What are the optimal purification strategies for recombinant SecF protein from E. coli?

When purifying recombinant SecF protein from E. coli, researchers should consider the following methodological approaches:

  • Periplasmic extraction rationale

    • The main reasons to produce recombinant proteins in the periplasm rather than cytoplasm are to:

      • "Enable disulfide bond formation"

      • "Facilitate protein isolation"

      • "Control the nature of the N-terminus of the mature protein"

      • "Minimize exposure to cytoplasmic proteases"

  • Protein targeting optimization

    • For effective SecF purification, researchers must address potential "hampered protein targeting, translocation and folding as well as protein instability" that "can all negatively affect periplasmic protein production yields"

    • Using appropriate signal peptides is critical, as they influence whether the protein follows co-translational or post-translational pathways

  • Cytoplasmic chaperone considerations

    • "The cytoplasmic chaperones SecB and Trigger Factor (TF) can assist the post-translational targeting of proteins"

    • "SecB can bind to a subset of secretory proteins and keeps them in a translocation-competent state"

    • "TF, which plays a key role in the folding of cytoplasmic proteins, can also keep secretory proteins in a translocation-competent state"

  • Translocation capacity enhancement

    • Research has shown that E. coli can adapt its translocation machinery, with "increased accumulation levels of at least three key players in protein translocation, SecA, LepB, and YidC"

    • These adaptations can be leveraged to improve protein yields during purification processes

How can proteomics approaches be used to study SecF interactions within the Sec-translocon complex?

Proteomics approaches offer powerful tools for investigating SecF interactions within the Sec-translocon complex:

  • Comparative proteome analysis

    • Recent studies have analyzed "the proteome composition of cells with enhanced periplasmic hGH production yields" to reveal adaptation mechanisms

    • This approach can identify changes in SecF and related proteins under different experimental conditions

  • Statistical significance determination

    • When analyzing proteomics data, researchers should focus on "statistically significant changes in their accumulation levels" of components involved in protein translocation

    • For example, studies identified that "SecA, LepB, and YidC, for only the last three components statistically significant changes in their accumulation levels were observed"

  • Systematic perturbation analysis

    • Researchers can use "rhamnose promoter-based production rate screening" to induce and study changes in the Sec-translocon complex

    • This approach has revealed that "E. coli adapts for enhanced periplasmic recombinant protein production through regulatory mechanisms rather than through the accumulation of mutations"

  • Integration with structural studies

    • Proteomics data can complement structural studies to provide a comprehensive understanding of SecF's position and function within the Sec-translocon

    • Such integrated approaches help determine how SecF contributes to "the biogenesis of cytoplasmic membrane proteins in conjunction with the Sec-translocon as well as an independent entity"

What experimental design strategies are most effective for studying SecF functionality in different E. coli strains?

When studying SecF functionality across different E. coli strains, researchers should implement these experimental design strategies:

  • Establish completely randomized designs

    • "The simplest independent-groups design is one where the researcher is interested in one IV with two or more levels—a completely randomized groups design"

    • "In an independent-groups or between-participants design, participants are randomly and independently assigned to each level of the IV"

    • This ensures "the assumption of initial equivalence of groups in experimental design"

  • Implement tunable expression systems

    • "By combining a rhamnose promoter-based expression vector and a strain background deficient in the rhamnose operon, a setup was created that enables precise regulation of protein production rates by varying the amount of rhamnose in the culture medium"

    • This approach allows for careful control of SecF expression across different strains

  • Apply multi-factorial experimental designs

    • When comparing multiple strains and conditions, researchers should:

      • "Focus on connecting the objectives of research to the type of experimental design required"

      • Describe "the actual process of creating the design and collecting the data"

      • Show "how to perform the proper analysis of the data"

      • Illustrate "the interpretation of results"

  • Develop strain-specific sensitivity tables

    • Create data tables showing how different strains respond to SecF modulation

    • "Data tables allow you to make all sorts of sensitivity and scenario analysis very quickly"

    • This approach allows identification of strain-specific effects that might otherwise be overlooked

What are emerging research questions regarding SecF's role in antimicrobial resistance mechanisms?

Given the critical role of the Sec-translocon in bacterial physiology, several emerging research questions regarding SecF's involvement in antimicrobial resistance merit investigation:

  • Stress adaptation and antibiotic survival

    • Since "E. coli adapts for enhanced periplasmic recombinant protein production through regulatory mechanisms rather than through the accumulation of mutations" , how might these same adaptation mechanisms contribute to antibiotic resistance?

    • Could modulation of SecF function alter the cell's response to antibiotics that target the cell envelope?

  • Secretion of resistance factors

    • How does SecF contribute to the secretion of proteins involved in antimicrobial resistance?

    • Could targeting SecF function provide a novel approach to combat antibiotic resistance by preventing the export of resistance determinants?

  • Cross-resistance phenomena

    • Does adaptation to secretory stress through SecF modulation confer cross-resistance to antibiotics?

    • Recent research has shown that "it is conceivable that the accumulation levels of more key players involved in protein translocation also go up" during adaptation - how might this broader adaptation impact antibiotic susceptibility?

  • Evolutionary considerations

    • Since "E. coli encounters in its natural habitat(s) conditions that require it to adapt its protein translocation machinery" , how has SecF evolved under selection pressure from antibiotics in clinical settings?

    • Could variations in SecF sequence or expression levels explain strain-specific differences in antimicrobial resistance profiles?

How might advances in synthetic biology and protein engineering impact our understanding of SecF function?

Advances in synthetic biology and protein engineering offer new opportunities to explore SecF function:

  • Engineered signal peptides

    • Development of synthetic signal peptides with optimized properties for SecF interaction

    • Building on findings that "Signal peptides of post-translationally targeted proteins can help to delay the folding of the mature domain in the cytoplasm" to enhance protein production

  • SecF protein variants

    • Creation of modified SecF proteins with altered functionality to probe structure-function relationships

    • Engineering SecF variants with enhanced activity for biotechnological applications

  • Synthetic Sec-translocon systems

    • Design of minimal or enhanced Sec-translocon systems incorporating modified SecF components

    • Building on understanding that "The Sec-translocon not only mediates the translocation of secretory proteins across the cytoplasmic membrane but also the insertion of membrane proteins into the cytoplasmic membrane"

  • Biomimetic membrane systems

    • Development of artificial membrane systems incorporating purified SecF and other Sec components

    • Using these systems to study SecF function in a controlled environment without cellular complexity

What computational approaches could enhance our understanding of SecF structure-function relationships?

Several computational approaches show promise for advancing our understanding of SecF:

  • Molecular dynamics simulations

    • Simulating SecF interactions with other Sec components and translocating proteins

    • Exploring how SecF contributes to "protein translocation across the cytoplasmic membrane" and how proteins are "mostly in an unfolded conformation" during this process

  • Machine learning for signal peptide optimization

    • Developing algorithms to predict optimal signal peptides for SecF-mediated translocation

    • Building on knowledge that "post-translational targeting/translocation is not only mediated by the signal peptide, but also by the so-called mature domain targeting sites in the mature part of the preprotein"

  • Systems biology modeling

    • Creating comprehensive models of the Sec-translocon system incorporating SecF

    • Modeling how "saturation of the Sec-translocon capacity can have negative effects on the formation of biomass and the production of proteins in the periplasm"

  • Evolutionary analysis

    • Tracing the evolution of SecF across bacterial species to identify conserved functional domains

    • Understanding how SecF adaptation mechanisms evolved to allow E. coli to "adapt its protein translocation capacity to its protein translocation needs"

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.