Recombinant Escherichia coli Protein transport protein HofC homolog (hofC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hofC; hopC; yacD; b0106; JW0102; Protein transport protein HofC homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-400
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
hofC
Target Protein Sequence
MASKQLWRWHGITGDGNAQDGMLWAESRTLLLMALQQQMVTPLSLKRIAINSAQWRGDKS AEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDLEQGIAFSNALLPWSEV FPPLYQAMIRTGELTGKLDECCFELARQQKAQRQLTDKVKSALRYPIIILAMAIMVVVAM LHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWSWLLVLFGFLLAIANKLLMRRPTW LIVRQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFLQGVESVRETMRCPYWVQLL TQIQHDISNGQPIWLALKNTGEFSPLCLQLVRTGEASGSLDLMLDNLAHHHRENTMALAD NLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGMG
Uniprot No.

Target Background

Database Links
Protein Families
GSP F family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What expression systems are most suitable for recombinant HofC production?

    The T7 expression system in E. coli BL21(DE3) strains is the most widely used platform for recombinant HofC expression. This system offers several advantages:

    • High-level protein production controlled by the T7 promoter

    • Reduced proteolytic degradation due to Lon and OmpT protease deficiency

    • Rapid biomass generation with shorter doubling time (~20 min)

    • Compatibility with various purification tags (His-tag being most common)

    A typical expression construct includes the HofC coding sequence cloned into a pET vector (such as pET28a) with an N-terminal His-tag for purification purposes .

  • What are the primary challenges in recombinant HofC expression?

    The main challenges in recombinant HofC expression include:

    • Membrane protein solubility issues and inclusion body formation

    • Potential toxicity to host cells when overexpressed

    • Maintaining proper folding of transmembrane domains

    • Achieving functional protein with correct post-translational modifications

    These challenges are common for membrane proteins and require optimization of expression conditions, including temperature, inducer concentration, and host strain selection .

Methodological Questions

  • What experimental controls are essential when assessing the biological activity of recombinant HofC?

    When evaluating recombinant HofC activity, include these essential controls:

    • Negative control: Empty vector-transformed cells processed identically

    • Positive control: Well-characterized membrane transport protein expressed under identical conditions

    • Folding assessment: Circular dichroism spectroscopy to verify secondary structure

    • Membrane integration: Fractionation analysis comparing cytoplasmic, membrane, and periplasmic fractions

    • Functional assay validation: Transport assays using fluorescent substrates or tracer-based uptake assays

    Additionally, cryo-EM structural analysis can verify proper folding and oligomeric state, as has been performed with other membrane transport proteins .

  • How should sample handling and transportation affect experimental design when working with recombinant HofC?

    Sample handling significantly impacts protein integrity and experimental outcomes:

    • Transportation method affects protein stability - pneumatic tube systems (PTS) subject samples to intense, irregular, multidirectional shocks

    • Hand-carried samples experience milder oscillations (~4 Hz ground frequency)

    • For sensitive applications like structural studies, always transport samples by hand

    • Document acceleration profiles during transport to account for potential structural changes

    • Include transport controls in experimental design to distinguish genuine results from artifacts

    Proteomic analysis has shown that transport methods can significantly alter protein composition and particle size distribution, potentially affecting downstream analyses and experimental reproducibility .

  • What strain-specific transcriptomic considerations impact HofC expression in different E. coli backgrounds?

    Transcriptomic analysis reveals important strain-specific differences that can impact recombinant expression:

    • K-12 and O157:H7 strains exhibit distinct gene expression patterns under stress conditions

    • B strains (like BL21) show different expression profiles for genes involved in:

      • Oxidative stress response (katG, trxC, ahpF, grxA)

      • Envelope stress response (rseC, ydcQ)

      • Iron and manganese uptake (exbD, fepD, ydiE, hemF, mntH)

      • Cold shock response (cspA, lpxP, csdA)

    For optimal HofC expression, consider strain-specific responses to temperature, pH, and other stressors. BL21(DE3) generally offers advantages for membrane protein expression due to its reduced protease activity and rapid growth characteristics .

  • How can systems biology approaches improve recombinant HofC production?

    Systems biology offers a holistic approach to optimize recombinant HofC expression:

    • Bioinformatics tools can predict membrane protein topology and optimal expression conditions

    • Modeling of protein 3D structure can identify pore-forming amino acids critical for function

    • 'Omics'-based systems-level analysis techniques provide insights into host cell responses

    • Structured, systematic approaches replace traditional trial-and-error optimization

    For example, protein homology/analogy recognition engines (Phyre2, EzMol) and pore analysis tools (Pore Walker) can identify structural features crucial for proper folding and function, as demonstrated with other membrane transport proteins .

Research Application Questions

  • How can recombinant HofC be utilized in structural biology studies?

    Recombinant HofC can advance structural biology through:

    • Cryo-EM analysis to determine membrane protein structure

    • Crystallization trials for X-ray diffraction studies

    • NMR studies of protein dynamics when isotopically labeled

    • Molecular dynamics simulations to understand transport mechanisms

    Recent advances in membrane protein structural biology have demonstrated the feasibility of such approaches. For example, the structure of MFSD1, another membrane transport protein, was determined by cryo-EM, revealing detailed molecular mechanisms of substrate recognition and transport .

  • What immune responses are generated against recombinant E. coli membrane proteins like HofC?

    Recombinant E. coli membrane proteins can elicit distinct immune responses:

    • Antibody production against exposed epitopes

    • Cellular immune responses, particularly Th17-type responses

    • Potential inflammatory responses to LPS contamination

    Studies with other E. coli outer membrane proteins have shown that antibodies generated against recombinant proteins may not recognize native proteins due to LPS O-chain shielding. For example, antibodies against recombinant OmpA reacted with rough mutants (rfb locus inactivated) but not with wild-type strains, suggesting that complete LPS O-chain precluded antibody accessibility .

    This has important implications for using recombinant HofC in vaccine development or diagnostic applications.

  • How do E. coli and yeast expression systems compare for HofC production?

    When considering expression systems for membrane proteins like HofC:

    FeatureE. coliYeast (S. cerevisiae/P. pastoris)
    Growth rateVery fast (20 min doubling)Moderate (90-120 min doubling)
    Expression levelOften high, but inclusion bodies commonLower but more properly folded
    Post-translational modificationsLimitedMore extensive eukaryotic modifications
    Membrane compositionProkaryoticEukaryotic (closer to human)
    Scale-up potentialExcellentGood
    Media costLowLow to moderate

    While E. coli remains the dominant host (approximately 60% of recombinant genes), P. pastoris usage has steadily increased for membrane proteins due to its superior folding environment and ability to achieve high biomass yields .

    For membrane proteins like HofC, yeast systems may provide advantages in proper folding and functional expression, particularly if eukaryotic-like membrane environment is important for function.

  • What are the latest advancements in optimizing E. coli expression systems for membrane proteins like HofC?

    Recent innovations in E. coli expression systems include:

    • Novel auto-expression media using galactose that can regulate the lac operon independent of known lac operon-regulated metabolism

    • Improved pET expression plasmids that address design flaws in genetic modules controlling transcription and translation

    • Strains engineered for improved disulfide bond formation in the cytoplasm

    • Selective pressure incorporation of non-canonical amino acids for structural studies

    For example, a newly developed galactose-based auto-expression system has demonstrated 8-fold increases in protein yields with ≥95% purity for challenging proteins. This system works across multiple E. coli strains, including those in which the endogenous lacZ has been disrupted .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.