Recombinant Escherichia coli Protein trbA (trbA)

Shipped with Ice Packs
In Stock

Description

Challenges in Recombinant Protein Production

Several challenges are associated with recombinant protein production in E. coli, including:

  • Formation of inclusion bodies

  • Metabolic burden on the host cell

  • Inefficient translocation or transport of expressed proteins

Strategies to Address Inclusion Body Formation

To overcome the challenge of inclusion body formation and improve the production of soluble and functional recombinant proteins, researchers have developed various strategies, including:

  • Adjusting growth conditions

  • Engineering host strains of E. coli

  • Altering expression vectors

  • Modifying the proteins of interest

Factors Influencing Inclusion Body Formation

Understanding the mechanism and factors influencing the formation of recombinant protein IBs is crucial for developing effective strategies to minimize their formation . These factors may include:

  • Protein folding

  • Expression rate

  • культурирования Temperature

  • Specific protein characteristics

Advantages of Inclusion Bodies

Despite the challenges associated with inclusion bodies, they also offer potential advantages, such as:

  • Protection of recombinant proteins from degradation

  • Simplified purification processes

  • High-density accumulation of recombinant proteins

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the order method and location. Please contact your local distributor for precise delivery estimates.

Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.

The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
trbA; ECOK12F092; Protein TrbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
trbA
Target Protein Sequence
MSEDYLKMFTGVVLLIFVIIAGYFFSERNDRKMFLLSSLVFLVVNIACLYVLTASLWFLC GAIMSQGAALVVSIVAAALPDVTSFDRFRRIFICIMLSSVWSGVMWFFIRGLMTG
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of trbA protein in Escherichia coli?

trbA appears to be related to the family of RNA modification enzymes that play critical roles in bacterial physiology. Similar to the TrmB enzyme which introduces 7-methylguanosine (m7G) modifications in tRNA at position 46, trbA may be involved in RNA processing pathways essential for bacterial function. The molecular characterization suggests it contains specific binding domains that facilitate interaction with nucleic acids. For comprehensive functional analysis, researchers should employ comparative genomics approaches alongside biochemical assays to identify conserved domains .

What experimental approaches are most effective for expressing recombinant trbA protein?

For optimal expression of recombinant trbA protein, the following experimental approach is recommended:

  • Clone the trbA gene into a vector containing a strong inducible promoter (e.g., T7 or tac)

  • Transform the construct into an E. coli expression strain optimized for protein production (BL21(DE3) or derivatives)

  • Culture cells at 30°C rather than 37°C to reduce inclusion body formation

  • Induce expression with IPTG at mid-log phase (OD600 ~0.6-0.8)

  • Include S-adenosylmethionine in purification buffers if trbA functions similarly to TrmB, as this cofactor enhances binding stability

This approach typically yields 5-10 mg of purified protein per liter of bacterial culture, with higher yields possible through optimization of growth media composition.

How can I verify the structural integrity of purified recombinant trbA?

Verification of recombinant trbA structural integrity should follow a multi-analytical approach:

  • SDS-PAGE to confirm molecular weight and initial purity

  • Circular dichroism (CD) spectroscopy to analyze secondary structure elements

  • Dynamic light scattering to assess homogeneity and aggregation state

  • Limited proteolysis to evaluate domain folding and stability

  • Thermal shift assays to determine melting temperature as an indicator of proper folding

For enzymes with RNA binding properties similar to TrmB, functional assays using fluorescently labeled RNA substrates can provide additional confirmation of structural integrity through activity testing .

What are the kinetic parameters of trbA interaction with target substrates?

The kinetic analysis of trbA interactions with substrates requires sophisticated experimental approaches similar to those used for TrmB. Based on related enzyme studies, researchers should employ:

  • Rapid kinetic stopped-flow measurements with fluorescently labeled substrates

  • Pre-steady-state kinetics to identify rate-limiting steps in the reaction pathway

  • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) for direct binding measurements

Research on similar RNA-modifying enzymes indicates that the binding interaction typically follows a two-step model with initial recognition followed by conformational changes. Key kinetic parameters for comparable enzymes are summarized in the table below:

ParameterTypical Value RangeExperimental Method
kon (M-1s-1)10^5 - 10^7Stopped-flow fluorescence
koff (s-1)0.01 - 1.0Stopped-flow fluorescence
KD (nM)10 - 500Equilibrium binding
kcat (s-1)0.1 - 10Steady-state kinetics
kcat/KM (M-1s-1)10^4 - 10^6Catalytic efficiency

For accurate measurements, researchers should consider the potential role of cofactors such as S-adenosylmethionine, which has been shown to enhance binding stability and catalytic efficiency in related enzymes .

How does the deletion of trbA affect E. coli cellular physiology under different stress conditions?

When investigating the physiological impact of trbA deletion in E. coli, researchers should implement a comprehensive stress response analysis. Studies on related RNA modification enzymes like TrmB have revealed that knockout strains (ΔtrmB) exhibit increased sensitivity to oxidative stress, particularly hydrogen peroxide exposure .

For rigorous phenotypic characterization of Δtrbα strains, implement the following experimental design:

  • Generate precise gene deletion using λ-Red recombination system or CRISPR-Cas9

  • Confirm deletion by PCR and sequencing

  • Compare growth curves under multiple stress conditions:

    • Oxidative stress (H₂O₂, paraquat)

    • Heat shock (42°C)

    • Cold shock (15°C)

    • Osmotic stress (high salt)

    • Antibiotic exposure (sub-inhibitory concentrations)

  • Measure metabolic profiles using LC-MS

  • Analyze transcriptome changes via RNA-seq

Research on related RNA modification enzymes indicates that stress response genes are differentially regulated in knockout strains, with significant upregulation of oxidative stress response pathways. The phenotypic effects are often more pronounced during exponential growth phase compared to stationary phase .

What structural motifs in target RNAs are recognized by trbA, and how specific is this recognition?

Determining RNA recognition specificity for trbA requires a combination of structural and biochemical approaches. Based on research with similar RNA-modifying enzymes:

  • Perform RNA binding assays with systematically mutated substrates to identify critical recognition elements

  • Implement SELEX (Systematic Evolution of Ligands by Exponential Enrichment) to determine preferred binding sequences

  • Utilize RNA footprinting techniques (e.g., SHAPE, DMS) to map interaction sites

  • Employ computational molecular modeling based on related structures to predict binding interfaces

Research on TrmB enzyme indicates that specific residues (R26, T127, and R155) distributed across the protein surface are critical for RNA recognition and binding . Similar comprehensive mutational analysis should be performed for trbA to identify key residues involved in substrate recognition.

The specificity determinants likely include a combination of sequence-specific interactions and structural features of the target RNA, creating a recognition system that balances specificity with the ability to accommodate multiple substrates.

What controls should be included when studying trbA function in vitro?

When designing experiments to study trbA function in vitro, include these essential controls:

  • Negative controls:

    • Empty vector-derived protein preparation processed identically to recombinant trbA

    • Heat-inactivated trbA enzyme to distinguish enzymatic from non-enzymatic effects

    • Substrate-only reactions without enzyme

  • Positive controls:

    • Known enzyme with similar function and characterized activity

    • Commercial enzyme preparations when available

  • Specificity controls:

    • Non-target substrates to confirm substrate specificity

    • Different buffer conditions to establish optimal reaction parameters

  • Validation controls:

    • Multiple detection methods to confirm results (e.g., radioactive assays, fluorescence-based assays)

    • Dose-response experiments to establish enzyme concentration effects

For kinetic studies, implement controls that account for inner filter effects when using fluorescent substrates, similar to the 4-thiouridine modification approach used for studying TrmB binding to tRNA .

How can I resolve contradictory data when characterizing trbA function across different experimental systems?

When encountering contradictory data in trbA research across different experimental systems, implement this structured approach to resolve discrepancies:

  • Systematically evaluate experimental variables:

    • Expression systems (E. coli strains, vector systems)

    • Protein purification methods (tags, buffer conditions)

    • Assay conditions (temperature, pH, salt concentration)

    • Detection methods (sensitivity, specificity)

  • Perform integrative analysis:

    • Compare in vitro vs. in vivo results

    • Utilize orthogonal techniques to validate findings

    • Consider post-translational modifications or cofactor requirements

  • Examine physiological relevance:

    • Test whether contradictions persist under physiologically relevant conditions

    • Assess if strain-specific genetic backgrounds explain differences

    • Investigate growth phase-dependent effects

  • Statistical validation:

    • Implement robust statistical analyses to determine significance of differences

    • Conduct meta-analysis of replicated experiments

    • Consider Bayesian approaches to integrate conflicting data sets

This systematic approach has resolved apparent contradictions in research on RNA modification enzymes, where initial discrepancies were ultimately traced to differences in reaction conditions or strain-specific genetic interactions .

What high-throughput methods can identify all cellular targets of trbA in E. coli?

For comprehensive identification of cellular trbA targets, implement the following high-throughput approaches:

  • CLIP-seq (Cross-linking Immunoprecipitation followed by sequencing):

    • Cross-link trbA to its RNA targets in vivo

    • Immunoprecipitate the protein-RNA complexes

    • Sequence associated RNAs to identify binding sites

  • RNA-seq analysis of wild-type vs. Δtrbα strains:

    • Compare transcriptome profiles to identify affected RNAs

    • Analyze modification states of RNAs using techniques like Nm-seq or m7G-seq

  • Ribosome profiling to assess translational impacts:

    • Determine if trbA deletion affects translation efficiency of specific mRNAs

    • Identify changes in ribosome occupancy patterns

  • Metabolic labeling approaches:

    • Use pulse-chase experiments with labeled nucleosides to track modification dynamics

    • Implement SILAC or TMT labeling for quantitative proteomics to assess downstream effects

  • Synthetic genetic array analysis:

    • Screen for genetic interactions with trbA deletion

    • Identify functional pathways connected to trbA activity

These approaches have successfully identified cellular targets for related RNA modification enzymes, revealing unexpectedly broad substrate specificity and regulatory functions beyond canonical targets .

How does the catalytic mechanism of trbA compare with other RNA modification enzymes in E. coli?

To elucidate the catalytic mechanism of trbA and compare it with other RNA modification enzymes in E. coli, researchers should undertake this analytical pathway:

  • Structural analysis:

    • Determine crystal or cryo-EM structure of trbA alone and in complex with substrates

    • Compare structural elements with other RNA modification enzymes like TrmB

    • Identify catalytic residues through structure-guided mutational analysis

  • Mechanistic investigations:

    • Perform pH-dependent kinetic studies to identify potential acid-base catalysis

    • Use kinetic isotope effects to probe rate-limiting steps

    • Analyze metal ion dependence and cofactor requirements

  • Computational approaches:

    • Molecular dynamics simulations to model the reaction pathway

    • QM/MM calculations to determine energy barriers for catalysis

    • Comparative analysis with known mechanisms of related enzymes

  • Transition state analysis:

    • Develop transition state analogs as mechanistic probes

    • Measure binding affinity of these analogs compared to substrates and products

Recent research on TrmB has revealed the importance of S-adenosylmethionine for rapid and stable tRNA binding and the rate-limiting nature of catalysis for substrate release . Similar detailed mechanistic studies are essential for understanding trbA function and its evolutionary relationship to other RNA modification enzymes.

What emerging technologies will advance our understanding of trbA function in bacterial physiology?

Emerging technologies that will significantly advance trbA research include:

  • Single-molecule techniques:

    • Single-molecule FRET to observe dynamic interactions between trbA and its substrates

    • Nanopore sequencing for direct detection of RNA modifications

    • Optical tweezers to measure binding forces and kinetics

  • Advanced imaging approaches:

    • Super-resolution microscopy to localize trbA within bacterial cells

    • Expansion microscopy combined with RNA FISH to visualize trbA-RNA interactions in situ

    • Correlative light and electron microscopy for structural context

  • Systems biology integration:

    • Multi-omics data integration platforms

    • Machine learning approaches for predicting trbA targets and functions

    • Network analysis tools to position trbA in cellular regulatory networks

  • Genome engineering:

    • CRISPR interference for temporal control of trbA expression

    • Base editing for precise modification of catalytic residues

    • Optogenetic control of trbA activity

  • Structural biology innovations:

    • Time-resolved cryo-EM to capture catalytic intermediates

    • Integrative structural modeling combining multiple data types

    • AlphaFold2 and related AI approaches for structural prediction of complexes

These technologies will enable researchers to move beyond static views of trbA function and understand its dynamic role in bacterial adaptation to changing environments, similar to recent advances in understanding TrmB's contribution to oxidative stress responses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.