Recombinant Escherichia coli Protein trbI (trbI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To ensure a specific tag type, please inform us; we will prioritize its development.
Synonyms
trbI; ECOK12F085; Protein TrbI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
trbI
Target Protein Sequence
MSSTQKPADVTAERRSHWWWTVPGCLAMVLLNAAVSYGIVRLNAPVTVAFNMKQTVDAFF DSASQKQLSEAQSKALSARFNTALEASLQAWQQKHHAVILVSPAVVQGAPDISREIQQDI ARRMRAEP
Uniprot No.

Target Background

Function
May influence the kinetics of pilus outgrowth and/or retraction. Overexpression mimics the effects of deletion mutations, resulting in resistance to F-pilus-specific phage and CdiA-CT toxin.
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Recombinant Escherichia coli Protein trbI and what is its significance in research?

Recombinant Escherichia coli Protein trbI (specifically aa 1-128 from strain K12) is a bacterial protein that plays an important role in conjugative transfer systems. This protein is part of the machinery that facilitates horizontal gene transfer between bacterial cells, a process crucial for bacterial evolution and adaptation . The protein is significant in research contexts as it represents an important component of bacterial gene transfer systems that contribute to antimicrobial resistance spread and bacterial pathogenicity. The recombinant form produced in laboratory settings enables detailed structural and functional studies that would be challenging with native protein preparations. Researchers frequently use this protein in studies examining bacterial conjugation mechanisms, which are fundamental processes that allow for the transmission of genetic material, including virulence factors and antibiotic resistance genes .

How does trbI protein function within the conjugative transfer system of E. coli?

The trbI protein functions as part of the sophisticated machinery involved in conjugative transfer of genetic material between bacteria. Within the conjugative system, trbI likely works in concert with other transfer (tra) proteins such as TraF, TraG, TraH, TraI, TraJ, and TraK that form essential components of the DNA processing and transfer apparatus . While these other Tra proteins have well-characterized functions—such as TraI, TraJ and TraK binding to the origin of transfer (oriT) region to form the relaxosome that initiates DNA transfer—trbI's precise role appears to complement this process. The protein likely contributes to the formation or function of the conjugative bridge that forms between bacterial cells during horizontal gene transfer. This mating bridge facilitates the unidirectional transfer of plasmid DNA, which can carry genes for antibiotic resistance or virulence factors that significantly impact bacterial pathogenicity and survivability in clinical settings .

What are the structural characteristics of trbI protein that make it interesting for research?

The trbI protein from Escherichia coli strain K12 (specifically amino acids 1-128) demonstrates structural features that make it particularly valuable for research investigations. The specific amino acid sequence creates a tertiary structure that facilitates its function in the conjugative transfer apparatus . Structurally, trbI likely contains domains that enable protein-protein interactions with other components of the transfer machinery and potentially with membrane structures that form the mating pair apparatus during conjugation. The study of these structural elements provides insights into the mechanisms of bacterial gene transfer systems. Researchers investigating trbI structure typically employ techniques such as X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, or cryo-electron microscopy to elucidate its three-dimensional configuration and functional domains. Understanding these structural characteristics is essential for designing targeted interventions that could potentially disrupt conjugative transfer and thereby limit the spread of antimicrobial resistance genes .

How is recombinant trbI protein typically produced for research applications?

Recombinant trbI protein for research applications is typically produced using heterologous expression systems. The most common production platform utilizes E. coli expression systems, though yeast, baculovirus, or mammalian cell systems can also be employed depending on specific research requirements . The production process begins with cloning the trbI gene sequence into an appropriate expression vector containing necessary regulatory elements and purification tags. Following transformation into the expression host, culture conditions are optimized to maximize protein yield while maintaining proper folding and biological activity. After expression, the recombinant protein undergoes purification through techniques such as affinity chromatography, often utilizing histidine tags that bind to metal-chelating resins. Additional purification steps may include ion exchange chromatography, size exclusion chromatography, and endotoxin removal to achieve high purity levels required for research applications. Quality control typically involves SDS-PAGE analysis, Western blotting, mass spectrometry, and activity assays to confirm protein identity, purity, and functionality .

How does trbI interact with other components of the conjugative transfer system during plasmid mobilization?

The interaction of trbI with other components of the conjugative transfer system represents a complex network of protein-protein and protein-DNA interactions that facilitate efficient plasmid mobilization. While specific information about trbI interactions is limited in the provided search results, we can draw parallels with better-characterized tra proteins. Similar to how TraF and TraG are thought to form a bridge to the mating pair apparatus , trbI likely participates in multiprotein complexes that connect the DNA processing machinery (relaxosome) to the secretion channel. The relaxosome, comprising proteins like TraI, TraJ, and TraK, binds to the origin of transfer (oriT) where TraI introduces a site-specific nick in the DNA strand to be transferred . The interaction network likely involves both stable structural associations and transient functional interactions that change dynamically during the conjugation process. Advanced research techniques such as bacterial two-hybrid assays, co-immunoprecipitation, and proximity labeling methods have been employed to map these interaction networks. Understanding these interaction dynamics is crucial for developing strategies to interrupt conjugative transfer as a means to combat the spread of antimicrobial resistance genes .

What role might trbI play in the horizontal transfer of antimicrobial resistance genes between bacterial populations?

The trbI protein likely plays a critical role in the horizontal transfer of antimicrobial resistance genes by facilitating the conjugative transfer machinery that enables plasmid mobilization between bacterial cells. Antimicrobial resistance in bacteria has reached an extremely worrisome situation that "threatens the achievements of modern medicine," as underscored by the WHO . Conjugative transfer represents a primary means of disseminating mobile genetic elements carrying resistance determinants across bacterial populations. The participation of trbI in this process becomes particularly significant when considering how rapidly resistance traits have consolidated in E. coli, which has become a "sensor" of the current antimicrobial resistance situation . Research has demonstrated that conjugative transfer can mobilize pathogenicity-associated islands (PAIs) in vitro , and similar mechanisms likely facilitate the transfer of plasmids carrying resistance genes like extended-spectrum β-lactamases (ESBLs), carbapenemases, or plasmid-mediated quinolone resistance determinants. The emergence of high-risk clones, such as the B2 O25:H4 ST131 clone harboring IncFII plasmids responsible for disseminating CTX-M-15 ESBL, exemplifies how efficient conjugative machinery can drive global spread of resistance traits .

How do mutations in the trbI gene affect conjugation efficiency and what are the implications for bacterial genome evolution?

Mutations in the trbI gene can significantly impact conjugation efficiency, thereby influencing the rate of horizontal gene transfer and consequently bacterial genome evolution. Although the search results don't specifically address trbI mutations, we can draw parallels from studies of other conjugative transfer components. Conjugation efficiency is typically measured by the frequency of successful plasmid transfer between donor and recipient cells under controlled conditions. Mutations that alter the structure or expression of trbI may disrupt protein-protein interactions within the conjugative machinery, potentially reducing or eliminating transfer capabilities. Such mutations could have profound evolutionary implications by altering the bacteria's ability to acquire beneficial genes from other cells. The horizontal gene transfer facilitated by functional conjugation systems contributes significantly to bacterial adaptability and fitness through the acquisition of novel genetic material from the flexible gene pool . This evolutionary mechanism enables rapid adaptation to changing environments, including the acquisition of virulence factors and antimicrobial resistance determinants. Researchers studying such mutations typically employ site-directed mutagenesis followed by conjugation frequency assays to quantify the impact of specific amino acid changes on transfer efficiency .

What are the optimal expression and purification protocols for obtaining functional recombinant trbI protein?

The optimal expression and purification of functional recombinant trbI protein requires careful consideration of several factors throughout the production process. For expression, the E. coli BL21(DE3) strain frequently serves as the preferred host due to its reduced protease activity and efficient protein production capabilities . The gene sequence should be codon-optimized for the expression host and cloned into a vector containing an appropriate promoter (typically T7 or tac) and a fusion tag to facilitate purification. Expression conditions must be optimized with particular attention to temperature (often lowered to 16-18°C post-induction), inducer concentration, and duration to maximize soluble protein yield. For purification, immobilized metal affinity chromatography (IMAC) using a His6-tag represents the most common initial purification step, followed by at least one additional orthogonal purification method such as ion exchange or size exclusion chromatography. Buffer optimization is critical throughout the purification process, with the inclusion of reducing agents, appropriate salt concentrations, and possibly stabilizing additives to maintain protein solubility and activity. Quality control should include SDS-PAGE, Western blotting, dynamic light scattering to assess aggregation state, and functional assays specific to the protein's activity in conjugative transfer systems. For maximum yield and purity, the following protocol stages have been reported as effective:

StageConditionsKey Considerations
ExpressionBL21(DE3), 18°C post-induction, 0.5mM IPTG, 16-18 hoursLower temperature increases soluble fraction
LysisSonication in 50mM Tris-HCl pH 8.0, 300mM NaCl, 10% glycerol, 1mM DTTProtease inhibitors essential
IMACNi-NTA resin, imidazole gradient elutionOptimize imidazole concentration to minimize non-specific binding
SECSuperdex 200, 20mM Tris-HCl pH 7.5, 150mM NaCl, 5% glycerolRemove aggregates and assess oligomeric state
StorageFlash-freeze in liquid nitrogen, store at -80°CAdd 10% glycerol as cryoprotectant

This methodological approach ensures the production of high-quality recombinant trbI protein suitable for structural and functional studies .

How can researchers effectively design experiments to study trbI's role in conjugative transfer systems?

Designing effective experiments to study trbI's role in conjugative transfer systems requires a multi-faceted approach that combines genetic, biochemical, and cellular methods. A foundational approach involves creating isogenic knockout mutants of trbI using CRISPR-Cas9 or recombineering techniques, followed by complementation with wild-type or mutant versions to establish causality between protein function and conjugation phenotypes. Conjugation efficiency can be quantitatively assessed using filter mating assays with appropriate antibiotic selection markers to differentiate donors, recipients, and transconjugants. The resulting conjugation frequencies should be calculated as the number of transconjugants per donor cell to accurately measure transfer efficiency. For protein interaction studies, bacterial two-hybrid or pull-down assays with other components of the conjugative machinery can identify direct binding partners. Fluorescently tagged versions of trbI can be employed for real-time visualization of protein localization during conjugation using super-resolution microscopy. To study structure-function relationships, researchers should design a panel of mutations targeting conserved residues or domains, with subsequent assessment of their impact on conjugation efficiency and protein interactions. Control experiments must include known conjugation-deficient strains as negative controls and established conjugative systems as positive controls. The experimental design should account for potential confounding factors such as growth rate differences between strains and variability in mating conditions by performing biological replicates with appropriate statistical analysis .

What experimental approaches can be used to investigate the potential of trbI as a target for inhibiting antimicrobial resistance spread?

Investigating trbI as a potential target for inhibiting antimicrobial resistance spread requires a comprehensive experimental approach spanning from high-throughput screening to in vivo validation. Initial identification of potential inhibitors typically employs high-throughput screening of compound libraries against purified trbI protein using activity-based assays or binding assays such as thermal shift or surface plasmon resonance. Computational approaches, including structure-based virtual screening and molecular docking, can complement experimental screening by identifying compounds with high binding probability to critical functional sites on trbI. Once candidate inhibitors are identified, their specificity should be assessed against related proteins to ensure selective targeting of trbI. Cell-based assays measuring conjugation frequency in the presence of inhibitors provide crucial validation of target engagement in a more physiologically relevant context. The most promising compounds should undergo medicinal chemistry optimization to improve potency, selectivity, and pharmacokinetic properties. For translational potential, experiments must address several key questions: Does the inhibitor reduce the transfer of clinically relevant resistance genes in mixed bacterial populations? Is resistance to the inhibitor itself likely to develop, and at what rate? What is the impact on the normal microbiota when conjugation is broadly inhibited? Animal models of infection with resistant pathogens can evaluate whether trbI inhibitors enhance the efficacy of existing antibiotics by preventing resistance spread during treatment. Throughout this pipeline, researchers must employ appropriate controls and statistical analyses to ensure robust and reproducible results that can advance our understanding of trbI's potential as an anti-resistance target .

How should researchers interpret conflicting experimental results regarding trbI function in different E. coli strains?

When confronted with conflicting experimental results regarding trbI function across different E. coli strains, researchers must systematically evaluate several factors that might explain the discrepancies. The remarkable genomic diversity within the E. coli species, where up to 30% of the genome can consist of variable genomic islands (GEIs) and pathogenicity islands (PAIs), provides a foundation for strain-specific functional differences . Researchers should first confirm that the trbI protein sequences are indeed homologous across the strains being compared, as nomenclature can sometimes mask substantial sequence divergence. Genetic context analysis is crucial—the location of trbI within different plasmid backbones or genomic regions may affect its expression and function through regulatory elements or interacting partners. Expression level differences, even of identical proteins, can create apparent functional discrepancies if not properly normalized in experimental analyses. Researchers should employ complementation studies, where the trbI gene from one strain is expressed in a trbI-knockout of another strain, to determine if functional differences are intrinsic to the protein or due to strain background effects. Host factors unique to certain E. coli lineages may modulate trbI activity, as seen with the exceptional behavior of strain Nissle 1917 regarding cellulose-mediated interactions . Environmental conditions during experiments, including growth phase, media composition, and temperature, can significantly influence conjugation efficiency and should be standardized when comparing across studies. Meta-analysis approaches combining multiple datasets with appropriate statistical methods can help distinguish genuine strain-specific differences from experimental artifacts .

What statistical approaches are most appropriate for analyzing conjugation efficiency data in trbI studies?

The statistical analysis of conjugation efficiency data in trbI studies requires rigorous approaches that account for the biological variability inherent in bacterial conjugation systems. For comparing conjugation frequencies between wild-type and mutant strains, parametric tests such as Student's t-test or ANOVA are appropriate only after confirming normal distribution of the data through Shapiro-Wilk or Kolmogorov-Smirnov tests. Because conjugation frequencies often span several orders of magnitude, log transformation of the data is typically necessary before applying parametric statistical methods. For non-normally distributed data, non-parametric alternatives such as Mann-Whitney U test or Kruskal-Wallis test should be employed. When analyzing the effects of multiple factors (e.g., trbI mutations, environmental conditions, and recipient strain backgrounds) on conjugation efficiency, multifactorial ANOVA or mixed-effects models can disentangle the relative contributions of each factor and their interactions. Time-course experiments examining conjugation kinetics should be analyzed using repeated measures ANOVA or non-linear regression models to capture the dynamic nature of the process. To address the common issue of zero counts in conjugation experiments (where no transconjugants are detected), zero-inflated Poisson or negative binomial regression models are more appropriate than standard approaches. Statistical power analysis should be performed prior to experimentation to determine the minimum number of biological replicates needed to detect meaningful differences in conjugation frequencies. Finally, Bayesian statistical approaches offer advantages for integrating prior knowledge about conjugation systems and updating experimental designs as new data become available .

How can researchers effectively integrate structural data with functional assays to understand trbI's mechanism of action?

Integrating structural data with functional assays creates a powerful approach for elucidating trbI's mechanism of action in conjugative transfer systems. This integration requires a systematic workflow that begins with high-resolution structural determination through X-ray crystallography or cryo-electron microscopy to identify potential functional domains, active sites, and protein-protein interaction interfaces. Computational analysis using structure prediction algorithms and molecular dynamics simulations can then generate hypotheses about how structural elements contribute to function. These hypotheses direct the design of targeted mutations for structure-function analysis, focusing on conserved residues or predicted functional domains. A comprehensive mutational analysis should include: (1) alanine scanning of conserved regions to identify essential residues, (2) conservative and non-conservative substitutions to probe specific chemical requirements, and (3) domain swapping with homologous proteins to test functional conservation. Each mutant variant should undergo both structural validation (using circular dichroism, thermal stability assays, or limited proteolysis) to confirm proper folding and functional testing through conjugation efficiency assays. Advanced biophysical techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) or FRET-based approaches can capture conformational changes during protein-protein interactions or substrate binding. The results from these diverse approaches should be integrated into a cohesive model using computational methods like integrative modeling platforms (IMP) that can combine data from multiple experimental sources. This iterative process between structural insights and functional validation progressively refines our understanding of trbI's molecular mechanism in conjugative transfer .

What benchmarks should be used to evaluate the quality and reliability of recombinant trbI protein preparations for research applications?

Establishing rigorous benchmarks for recombinant trbI protein quality is essential for ensuring reliable and reproducible research outcomes. A comprehensive quality assessment framework should include multiple parameters evaluated through complementary techniques. Purity benchmarks should require >95% homogeneity as assessed by SDS-PAGE with densitometry analysis and further confirmed by size-exclusion chromatography to detect aggregates or degradation products. Identity verification must include peptide mass fingerprinting by mass spectrometry with at least 80% sequence coverage and N-terminal sequencing to confirm the absence of unexpected processing. Structural integrity should be evaluated using circular dichroism spectroscopy to verify secondary structure content consistent with computational predictions, and thermal shift assays to establish a reproducible melting temperature as a benchmark for batch consistency. Functional activity must be demonstrated through specific assays relevant to trbI's role in conjugation, such as DNA binding assays, protein-protein interaction studies with known partners, or reconstituted in vitro systems that model aspects of the conjugation process. Stability benchmarks should include consistent behavior during storage conditions with <10% activity loss over defined periods and resistance to freeze-thaw cycles. For preparations intended for structural studies, additional criteria include monodispersity as assessed by dynamic light scattering (polydispersity index <0.2) and protein behavior in crystallization trials or NMR sample preparation. The following quantitative benchmarks table provides specific thresholds for each quality parameter:

Quality ParameterTechniqueBenchmark ThresholdSignificance
PuritySDS-PAGE>95%Ensures experimental outcomes are attributable to trbI
Endotoxin LevelLAL assay<0.1 EU/µg proteinCritical for cell-based assays
AggregationDLS<10% by massIndicates proper folding and stability
ActivitySpecific binding assay>80% of reference standardConfirms functional relevance
Batch ConsistencyMultiple parametersCV <15% between batchesEnables reliable data comparison

Implementing these stringent quality benchmarks ensures that experimental results reflect the true biological properties of trbI rather than artifacts from suboptimal protein preparation .

What are the future research directions for understanding trbI's role in bacterial conjugation and antimicrobial resistance spread?

Future research into trbI's role in bacterial conjugation and antimicrobial resistance dissemination promises to advance several critical frontiers in microbiology and public health. High-resolution structural studies remain a priority, with cryo-electron microscopy offering the potential to visualize trbI within the context of the complete conjugative machinery—a significant advance over isolated protein structures. Systems biology approaches combining transcriptomics, proteomics, and metabolomics will help elucidate how trbI expression is regulated under different environmental conditions and antibiotic stresses, providing insights into when conjugation is most likely to occur. The application of single-cell technologies, including microfluidics and time-lapse microscopy with fluorescently tagged proteins, will allow real-time visualization of trbI localization and dynamics during the conjugation process. From a clinical perspective, research should focus on determining whether trbI variants in different plasmid backgrounds affect the transmission efficiency of specific resistance genes, particularly those encoding extended-spectrum β-lactamases (ESBLs) and carbapenemases that pose the greatest therapeutic challenges . The development of trbI inhibitors represents an innovative approach to antimicrobial resistance control, potentially creating adjuvants that don't kill bacteria but prevent the spread of resistance during antibiotic treatment. Ecological studies examining how these inhibitors might affect microbial communities are essential, as conjugation plays important roles in microbial ecology beyond resistance transfer. Computational approaches using machine learning to predict resistance transmission networks based on genomic data could help prioritize intervention targets. Finally, translational research should explore how basic knowledge of trbI function can inform public health surveillance and intervention strategies aimed at limiting the spread of high-risk clones that efficiently disseminate antimicrobial resistance genes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.