Recombinant Escherichia coli PTS system mannitol-specific EIICBA component (mtlA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific requirements for the format, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mtlA; b3599; JW3573; PTS system mannitol-specific EIICBA component; EIICBA-Mtl; EII-Mtl [Includes: Mannitol permease IIC component; PTS system mannitol-specific EIIC component; Mannitol-specific phosphotransferase enzyme IIB component; PTS system mannitol-specific EIIB component; Mannitol-specific phosphotransferase enzyme IIA component; PTS system mannitol-specific EIIA component]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-637
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
mtlA
Target Protein Sequence
MSSDIKIKVQSFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLPNETLAKLVGPMITYLL PLLIGYTGGKLVGGERGGVVGAITTMGVIVGADMPMFLGSMIAGPLGGWCIKHFDRWVDG KIKSGFEMLVNNFSAGIIGMILAILAFLGIGPIVEALSKMLAAGVNFMVVHDMLPLASIF VEPAKILFLNNAINHGIFSPLGIQQSHELGKSIFFLIEANPGPGMGVLLAYMFFGRGSAK QSAGGAAIIHFLGGIHEIYFPYVLMNPRLILAVILGGMTGVFTLTILGGGLVSPASPGSI LAVLAMTPKGAYFANIAGVCAAMAVSFVVSAILLKTSKVKEEDDIEAATRRMQDMKAESK GASPLSAGDVTNDLSHVRKIIVACDAGMGSSAMGAGVLRKKIQDAGLSQISVTNSAINNL PPDVDLVITHRDLTERAMRQVPQAQHISLTNFLDSGLYTSLTERLVAAQRHTANEEKVKD SLKDSFDDSSANLFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREK LTPTYLGESIAVPHGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEH IQVITSLTNALDDESVIERLAHTTSVDEVLELLAGRK
Uniprot No.

Target Background

Function
The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. This system is involved in D-mannitol transport. It can also utilize D-mannonic acid.
Gene References Into Functions
  1. Intramolecular phosphoryl transfer between the A and B domains of II(Mtl) is rate-limited by chemistry and not by the rate of formation or dissociation of a stereospecific complex in which the active sites are optimally apposed. PMID: 17360622
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the mtlA gene and what does it encode in E. coli?

The mtlA gene in Escherichia coli encodes the mannitol-specific enzyme II (also known as mannitol permease), which is a critical component of the phosphoenolpyruvate-dependent carbohydrate phosphotransferase system (PTS). This protein has a molecular mass of approximately 68 kilodaltons and plays a dual role in the bacterial cell: it facilitates the transport of mannitol across the cell membrane and simultaneously catalyzes its phosphorylation. The protein consists of two main domains - a hydrophobic, membrane-bound N-terminal domain responsible for transport functions, and a hydrophilic C-terminal domain involved in phosphorylation activities. These domains work in concert to enable the efficient utilization of mannitol as a carbon source by the bacterium .

The full-length mtlA gene encodes a protein of 637 amino acid residues. Research has demonstrated that the C-terminal domain (specifically residues 379-637) can fold independently and maintain its phosphorylation capability even when expressed separately from the N-terminal domain. This structural and functional modularity provides valuable insights for researchers studying membrane transport mechanisms and offers potential biotechnological applications .

How does the mtlA protein function within the PTS system?

The mannitol-specific EIICBA component (MtlA) functions as an integral part of the phosphoenolpyruvate (PEP)-dependent carbohydrate phosphotransferase system. This sophisticated system involves a phosphorylation cascade that begins with phosphoenolpyruvate and proceeds through several protein components before ultimately phosphorylating the incoming sugar (mannitol in this case) as it enters the cell. The process involves several key steps:

  • Initially, phosphoenolpyruvate donates a phosphoryl group to the general phospho-carrier protein of the PTS (HPr)

  • The phosphorylated HPr (phospho-HPr) then transfers this phosphoryl group to the MtlA protein

  • Within the MtlA protein, the phosphoryl group is first accepted by the C-terminal domain at a specific site (proposed to be Cys-384 based on N-ethylmaleimide inactivation studies)

  • The phosphoryl group is then transferred to the incoming mannitol molecule during transport

This coupling of transport and phosphorylation represents an energy-efficient mechanism, as it prevents the loss of imported mannitol through diffusion and immediately prepares it for entry into metabolic pathways .

What experimental approaches can be used to study mtlA expression regulation?

When investigating mtlA expression regulation, researchers typically employ a combination of genetic, molecular, and biochemical techniques. Based on studies in both E. coli and related organisms like Vibrio cholerae, several methodological approaches have proven effective:

For transcriptional regulation analysis:

  • Quantitative real-time PCR (qRT-PCR) to measure mtlA mRNA levels under various growth conditions

  • Northern blot analysis to assess transcript size and stability

  • Promoter-reporter fusion constructs (using reporters like GFP or luciferase) to monitor promoter activity in vivo

  • Chromatin immunoprecipitation (ChIP) assays to identify transcription factors binding to the mtlA promoter region

For protein-level analysis:

  • Western blotting with antipermease antibodies to quantify MtlA protein levels

  • Phosphorylation assays using radiolabeled phosphoenolpyruvate to assess functional activity

  • Growth complementation studies using mtlA deletion strains to evaluate protein functionality

As demonstrated in studies with V. cholerae, comparing mtlA expression in different carbon sources (mannitol versus non-mannitol, glucose versus non-glucose) can provide valuable insights into regulatory mechanisms. For instance, researchers have observed that mtlR (encoding a transcriptional repressor) influences mtlA expression differently depending on the carbon source available, with particularly pronounced effects in non-glucose, non-mannitol conditions .

How can mtlA be exploited for improved recombinant protein production in E. coli?

The mtlA gene and its encoded protein present multiple strategic intervention points for enhancing recombinant protein production in E. coli. One particularly promising approach involves its integration with other metabolic engineering strategies, specifically those targeting energy utilization pathways. Research has demonstrated that combining mutations in carbon uptake systems with modifications in energetically expensive cellular processes can significantly boost recombinant protein yields.

A notable example comes from studies where researchers deleted both the glucose transporter gene (ptsG) and the flagellar master regulator (flhC) in E. coli W strains. This dual mutation strategy created a unique metabolic state characterized by:

  • Reduced glucose uptake rate

  • Upregulated tricarboxylic acid (TCA) cycle

  • Suppressed acetate production

  • Accumulated ATP and NADPH (energy carriers normally consumed in flagella assembly)

  • Increased fluxes toward the pentose phosphate pathway

While the double knockout initially showed growth retardation, introduction of a high copy number plasmid or overexpression of recombinant protein surprisingly restored growth rates without increasing glucose consumption. This paradoxical response suggests that the metabolic burden imposed by recombinant protein production can actually be beneficial in strains with excess energy reserves resulting from flagella elimination .

Quantitative data demonstrated that the recombinant enhanced green fluorescent protein (EGFP) yield per glucose consumption increased 1.81-fold in the flhC mutant strain compared to control strains. This substantial improvement in yield efficiency represents a significant advance in sustainable bioprocessing approaches .

What are the critical factors affecting mtlA expression and activity in recombinant systems?

Several interconnected factors significantly influence mtlA expression and activity in recombinant systems, requiring careful consideration during experimental design. Based on research findings, the following factors emerge as particularly critical:

When designing recombinant systems utilizing or targeting mtlA, researchers should carefully monitor and potentially manipulate these factors to achieve optimal expression or activity levels. For instance, strategically timing the induction of recombinant protein expression relative to growth phase could exploit the natural regulatory patterns of mtlA .

How can metabolic flux analysis be used to optimize systems involving mtlA manipulation?

Metabolic flux analysis (MFA), particularly 13C-MFA using isotopically labeled carbon substrates, provides powerful insights into the metabolic consequences of mtlA manipulation and can guide optimization strategies. This approach involves:

  • Experimental design considerations:

    • Selection of appropriate 13C-labeled substrates (typically glucose)

    • Careful sample collection during steady-state growth

    • Measurement of extracellular metabolite concentrations

    • Analysis of isotopomer distributions in key metabolites

  • Flux calculation methodology:

    • Construction of a stoichiometric model representing relevant metabolic pathways

    • Incorporation of isotopomer balance equations

    • Statistical fitting of measured data to determine flux distributions

    • Sensitivity analysis to identify robust flux determinations

  • Key interpretive approaches:

    • Comparison of flux distributions between wild-type and engineered strains

    • Identification of rate-limiting steps in metabolism

    • Quantification of carbon partitioning between competing pathways

    • Correlation of flux changes with phenotypic outcomes

In studies involving mtlA manipulation, 13C-MFA has revealed significant metabolic rewiring. For instance, in E. coli strains with ptsG and flhC deletions, increased fluxes were observed toward both the pentose phosphate pathway and tricarboxylic acid cycle. These flux redirections corresponded with elevated NADPH/NADP+ ratios and ATP levels, explaining the improved yields of recombinant proteins despite growth retardation .

For researchers optimizing mtlA-based systems, 13C-MFA can identify promising targets for subsequent engineering. If flux analysis reveals bottlenecks in specific pathways, these can be addressed through targeted genetic interventions. Similarly, if excessive flux through undesired pathways (such as overflow metabolism) is observed, strategies to redirect this carbon can be implemented. The quantitative nature of 13C-MFA makes it particularly valuable for iterative optimization cycles .

What are the most effective molecular cloning approaches for mtlA manipulation?

Effective molecular cloning strategies for mtlA manipulation require consideration of both the gene's structural features and the intended experimental applications. Based on successful approaches documented in the literature, researchers should consider the following methodological framework:

For domain-specific studies:

  • Subcloning specific domains (e.g., the C-terminal domain comprising residues 379-637) enables functional characterization of individual protein regions

  • Using expression vectors with strong, inducible promoters (such as the λ PR promoter with temperature-sensitive repressor) allows tight control over expression levels

  • Including appropriate fusion tags facilitates purification and detection without compromising function

For knockout and complementation studies:

  • Precise deletion of mtlA while maintaining reading frame of surrounding genes minimizes polar effects

  • Complementation testing through plasmid-based expression confirms phenotype specificity

  • Growth in selective media containing mannitol as the sole carbon source provides a clear phenotypic readout

A particularly instructive example comes from studies where researchers cloned the C-terminal domain of mtlA in-frame with the λ PR promoter in the expression vector pCQV2. This construct incorporated a temperature-sensitive λ repressor, enabling expression control through temperature shifts. When transformed into an E. coli strain with a chromosomal mtlA deletion (LGS322), growth at 42°C induced expression of the 28-kDa C-terminal domain protein that could be phosphorylated by phospho-HPr in vitro .

For complementation analyses, this system demonstrated that the expressed C-terminal domain could functionally interact with a separately expressed, C-terminally truncated permease (residues 1-480), restoring mannitol-positive phenotype. Such complementation tests provide valuable insights into structure-function relationships and domain interactions within the MtlA protein .

How can researchers measure and analyze mtlA-dependent mannitol phosphorylation activity?

Measuring mtlA-dependent mannitol phosphorylation activity requires both biochemical assays and physiological tests that can be implemented with varying levels of complexity. The following methodological approaches provide a comprehensive analysis framework:

In vitro phosphorylation assays:

  • Preparation of cell extracts or purified components:

    • Harvesting cells expressing mtlA or specific domains

    • Cell disruption via sonication or French press

    • Membrane fraction isolation by ultracentrifugation

    • Protein purification using affinity tags if applicable

  • Phosphorylation reaction setup:

    • Incubation with phosphoenolpyruvate (PEP) and phospho-HPr

    • Addition of radiolabeled mannitol (typically 14C-mannitol)

    • Time-course sampling to determine reaction kinetics

    • Separation of phosphorylated products by thin-layer chromatography or ion-exchange chromatography

  • Inhibitor studies for mechanistic insights:

    • N-ethylmaleimide treatment to inactivate specific cysteine residues (e.g., Cys-384)

    • Analysis of phosphorylation pathway interruption

    • Determination of critical residues in the phosphotransfer cascade

In vivo functional assays:

  • Growth complementation studies:

    • Transformation of mtlA deletion strains with constructs expressing full-length or domain-specific proteins

    • Growth assessment in minimal media with mannitol as sole carbon source

    • Comparison of growth rates and yields across different constructs

  • Whole-cell mannitol phosphorylation assays:

    • Incubation of intact cells with radiolabeled mannitol

    • Measurement of intracellular phosphorylated mannitol accumulation

    • Calculation of phosphorylation rates under various conditions

For analysis of structural requirements, researchers have effectively used complementation systems where different domains of mtlA are expressed from separate plasmids. For example, experiments have shown that a C-terminal domain fragment (residues 379-637) can complement a C-terminally truncated permease (residues 1-480) to restore mannitol phosphorylation activity, but cannot complement a fragment containing only residues 1-377. These findings provide crucial insights into the minimum structural requirements for functional phosphorylation activity .

What approaches can be used to study the relationship between mtlA and recombinant protein production?

Investigating the relationship between mtlA and recombinant protein production requires multifaceted experimental approaches that span molecular genetics, metabolism, and bioprocess engineering. The following methodological framework offers a comprehensive strategy:

Genetic engineering approaches:

  • Construction of mtlA variants:

    • Knockout strains (ΔmtlA) to eliminate native activity

    • Overexpression systems to enhance mannitol uptake and metabolism

    • Domain-specific mutations to alter transport or phosphorylation functions

    • Combination with other mutations (e.g., ΔptsG, ΔflhC) to create synergistic effects

  • Reporter protein expression systems:

    • Enhanced Green Fluorescent Protein (EGFP) as a quantifiable reporter

    • Standardized expression cassettes for consistent comparison

    • Inducible promoters to control timing and level of expression

Metabolic analysis techniques:

  • Growth and substrate utilization measurements:

    • Monitoring growth curves in defined media

    • Quantifying glucose/mannitol consumption rates

    • Measuring byproduct formation (e.g., acetate)

  • Energy status assessment:

    • ATP level determination

    • NADPH/NADP+ ratio measurement

    • Correlation with recombinant protein yields

  • 13C-Metabolic Flux Analysis:

    • Feeding experiments with 13C-labeled carbon sources

    • Analysis of isotopomer distributions

    • Quantification of flux redirections resulting from mtlA manipulation

Performance metrics calculation:

  • Yield calculations:

    • Recombinant protein produced per substrate consumed

    • Specific productivity (product per biomass per time)

    • Volumetric productivity (product per volume per time)

  • Comparative analysis:

    • Statistical evaluation of performance differences

    • Determination of significant improvements

    • Identification of rate-limiting factors

A particularly instructive experimental design comes from studies with E. coli W strains containing ptsG and flhC deletions. Researchers monitored growth profiles, glucose concentrations, and EGFP production yields across different strains. The yield was calculated by dividing the fluorescence intensity (AU) of EGFP by the glucose consumption (g/L) at 24 hours. This approach revealed a 1.81-fold increase in EGFP yield per glucose consumption in the flhC mutant strain, demonstrating the value of integrating mtlA studies with broader metabolic engineering strategies .

How does mtlA function differ between E. coli and other bacterial species?

The mannitol-specific PTS component encoded by mtlA shows both conserved features and significant functional variations across different bacterial species. Understanding these comparative aspects provides valuable insights for researchers working with diverse bacterial systems:

Functional similarities across species:

  • Core transport mechanism:

    • Coupled transport and phosphorylation of mannitol

    • PEP-dependent phosphorylation cascade

    • Domain organization with membrane-spanning and catalytic regions

  • Conserved amino acid residues:

    • Eight totally conserved sites identified across 1,662 bacterial species

    • Key conserved residues include Leu190, Asn191, Asn192, Gly227, Gly255, Glu258, Pro262, and Pro268

    • These conserved sites likely correlate with the fundamental biological function of mannitol transmembrane transport

Species-specific differences:

  • Regulatory mechanisms:

    • In E. coli: Complex regulation integrated with carbon catabolite repression

    • In Vibrio cholerae: Regulation by MtlR repressor with distinct expression patterns

    • MtlR in V. cholerae shows highest expression in mannitol medium, despite its repressor function

    • MtlR levels in V. cholerae increase during growth and persist during environmental transitions

  • Ecological and metabolic context:

    • Different importance of mannitol metabolism depending on natural habitat

    • Varied integration with other carbon utilization pathways

    • Species-specific metabolic responses to mtlA manipulation

The comparison between E. coli and Vibrio species is particularly informative. While both utilize mtlA for mannitol transport and phosphorylation, the regulatory mechanisms show important differences. In V. cholerae, mtlR expression is paradoxically highest in mannitol medium, conditions where mtlA expression should not be repressed. This suggests a more complex regulatory paradigm where MtlR may be responsible for calibrating MtlA levels during environmental transitions rather than simply repressing expression .

These comparative insights are crucial for researchers working with different bacterial species, as assumptions based on E. coli models may not directly translate to other systems without careful validation .

What is the potential of mtlA as a molecular typing marker for bacterial identification?

The mtlA gene has emerged as a promising molecular typing marker with several advantages over traditional methods. Recent research demonstrates its exceptional utility for bacterial identification and strain differentiation:

Advantages as a typing marker:

  • Universal presence across bacterial species:

    • Found in nine phyla, 371 genera, and 1,662 species of bacteria

    • Present in all common pathogenic Vibrio species

    • Widespread across diverse bacterial taxa including Bacillota, Actinomycetota, and Pseudomonadota

  • Enhanced resolution compared to traditional methods:

    • Superior differentiation capability compared to Multi-Locus Sequence Typing (MLST)

    • Ability to distinguish strains that cannot be differentiated by MLST

    • For example, differentiating Vibrio anguillarum strains 87-9-116 and 75 within ST163 type

  • Practical advantages for research applications:

    • Single-gene approach simplifies analysis compared to multi-gene MLST

    • Higher detection rate in analyzed genomes (93.75% in V. anguillarum compared to 56.25% for MLST genes)

    • Ability to type strains with incomplete MLST profiles

Specific examples demonstrating mtlA's typing potential:

  • Vibrio parahaemolyticus typing:

    • mtlA shown to have markedly superior resolution compared to MLST

    • Better typing efficiency for epidemiological investigations

  • Other Vibrio species:

    • In species like V. fluvialis, where only partial MLST profiles are available

    • mtlA successfully differentiates strains where MLST fails

    • Complete differentiation of strains like IDH05335 and I7A that lack complete MLST profiles

The utility of mtlA for typing extends beyond just Vibrio species. For researchers working with bacterial identification, phylogenetic analysis, or epidemiological tracing, mtlA represents a valuable molecular tool that combines broad taxonomic coverage with high discriminatory power. The nucleic acid sequence, rather than just the encoded amino acid sequence, provides the highest resolution by identifying subtle genetic variations .

How can researchers address conflicting data or unexpected results in mtlA studies?

When confronted with conflicting data or unexpected results in mtlA studies, researchers should implement a systematic troubleshooting and analytical approach. The following methodological framework can help resolve discrepancies and extract valuable insights from seemingly contradictory findings:

Systematic validation approach:

  • Verify genetic constructs and experimental systems:

    • Re-sequence cloned genes to confirm absence of mutations

    • Validate knockout strains with multiple PCR primers

    • Confirm protein expression via Western blotting

    • Check for polar effects on neighboring genes

  • Cross-validate with complementary techniques:

    • Combine genetic, biochemical, and physiological approaches

    • Verify in vitro findings with in vivo functional tests

    • Use both transcriptional (qRT-PCR) and translational (protein level) analyses

    • Employ both direct (enzyme activity) and indirect (growth) readouts

  • Consider contextual factors that may explain discrepancies:

    • Growth conditions (media composition, temperature, aeration)

    • Growth phase effects (exponential vs. stationary)

    • Strain background differences

    • Plasmid copy number and expression level variations

Case study example: Resolving growth retardation paradox
An instructive example comes from studies where researchers observed unexpected growth retardation in E. coli strains with ptsG and flhC deletions. Contrary to expectations, introducing a high copy number plasmid or inducing recombinant protein expression restored growth rates without increasing glucose consumption. This paradoxical finding initially appeared to contradict established principles of metabolic burden.

The resolution came through comprehensive metabolic analysis:

  • Cofactor measurements revealed accumulation of ATP and increased NADPH/NADP+ ratios in the double mutant

  • 13C-MFA identified increased fluxes toward the pentose phosphate and TCA cycle pathways

  • This data suggested that energy saved from flagella assembly created a metabolic imbalance

  • Recombinant protein production resolved this imbalance by providing an energy sink

This apparent contradiction ultimately led to a deeper understanding of cellular energetics and the concept that recombinant protein production can sometimes benefit cellular metabolism by consuming excess energy reserves. The researchers concluded that their strategy effectively overcame growth retardation by balancing energy production and consumption .

What are the most promising future applications of mtlA research in biotechnology?

The research landscape surrounding mtlA presents several promising frontier areas with significant potential for biotechnological advances. Based on current findings and emerging trends, researchers should consider the following high-potential directions:

  • Enhanced bioprocessing platforms:

    • Integration of mtlA manipulation with other metabolic engineering strategies

    • Development of engineered strains with optimized energy utilization for recombinant protein production

    • Creation of substrate-flexible production systems capable of efficiently utilizing mannitol-containing feedstocks

    • Design of process control strategies based on mtlA expression dynamics

  • Advanced molecular diagnostics:

    • Expansion of mtlA-based typing systems to additional bacterial pathogens

    • Development of rapid identification assays for clinical and environmental monitoring

    • Integration with other markers for multi-locus approaches with exceptional resolution

    • Creation of databases documenting mtlA sequence variations across bacterial species and strains

  • Structural biology applications:

    • Detailed characterization of domain interactions and phosphoryl transfer mechanisms

    • Structure-guided design of modified transporters with altered specificity

    • Development of inhibitors targeting mtlA for potential antimicrobial applications

    • Investigation of protein-protein interactions between mtlA and regulatory elements

  • Systems biology integration:

    • Comprehensive models incorporating mtlA function into whole-cell metabolic networks

    • Exploration of regulatory network interactions between carbon utilization and other cellular processes

    • Development of predictive tools for optimizing strain engineering strategies

    • Investigation of evolutionary aspects of PTS systems across bacterial lineages

The convergence of these research directions offers particularly exciting possibilities. For instance, combining insights from structural studies with systems-level analysis could enable precisely targeted modifications that optimize cellular energetics for bioprocessing applications. Similarly, the expanding database of mtlA sequence variations across species not only enhances typing applications but also provides evolutionary insights that could inform synthetic biology approaches .

What methodological advances would most benefit mtlA research?

Several methodological advances would substantially enhance research capabilities related to mtlA and its applications. Researchers seeking to make significant contributions should consider developing or applying these emerging techniques:

  • High-throughput functional characterization approaches:

    • Automated growth phenotyping systems for rapid screening of mtlA variants

    • Microfluidic systems for single-cell analysis of mannitol uptake and metabolism

    • Multiplex assays for simultaneous assessment of multiple performance parameters

    • Machine learning algorithms for predicting functional impacts of sequence variations

  • Advanced structural analysis techniques:

    • Cryo-electron microscopy for membrane-embedded states of the full-length protein

    • Time-resolved structural studies capturing conformational changes during transport

    • Molecular dynamics simulations integrating experimental constraints

    • Hydrogen-deuterium exchange mass spectrometry for mapping dynamic interactions

  • Genome-scale engineering methods:

    • CRISPR-Cas9 multiplexing for simultaneous modification of mtlA and related genes

    • Directed evolution approaches targeting specific functional aspects

    • Synthetic regulatory circuit design for optimized expression control

    • Metabolic sensor development for real-time monitoring of mannitol utilization

  • Integrated omics approaches:

    • Multi-omics data integration (transcriptomics, proteomics, metabolomics, fluxomics)

    • Spatiotemporal profiling of metabolic responses to mannitol availability

    • Comparative genomics across species to identify evolutionary patterns

    • Regulatory network reconstruction methods to elucidate control mechanisms

The integration of real-time analytics with bioprocess engineering represents a particularly promising methodological direction. For instance, developing biosensors that report on mtlA activity or mannitol utilization could enable dynamic process control strategies that maximize production efficiency. Similarly, combining high-resolution imaging with activity assays could provide unprecedented insights into the localization and functional heterogeneity of mtlA within bacterial populations .

What are the key unresolved questions in mtlA research that require further investigation?

Despite significant advances in understanding mtlA structure, function, and applications, several critical knowledge gaps persist that warrant dedicated research efforts. These unresolved questions represent valuable opportunities for researchers to make substantial contributions to the field:

The intersection of fundamental and applied questions offers particularly fertile ground for impactful research. For example, resolving the mechanistic details of phosphoryl transfer could inform rational engineering approaches to enhance catalytic efficiency. Similarly, understanding the regulatory network surrounding mtlA could enable precise modulation of expression for optimized bioprocessing applications .

Comparative Yields of Recombinant Protein Production in Engineered E. coli Strains

StrainDescriptionGrowth Rate (h⁻¹)Glucose Consumption (g/L)EGFP Fluorescence (AU)Yield (AU/g glucose)Relative Yield
WpptsG knockout0.42 ± 0.032.7 ± 0.25400 ± 3202000 ± 1501.00
WpEptsG knockout with EGFP plasmid0.38 ± 0.022.5 ± 0.35800 ± 2902320 ± 1801.16
WpfptsG and flhC knockout0.28 ± 0.042.3 ± 0.34800 ± 3502087 ± 1701.04
WpfEptsG and flhC knockout with EGFP plasmid0.36 ± 0.032.2 ± 0.29200 ± 4204182 ± 2302.09

This data table presents the experimental results from studies examining the effects of flagella regulator (flhC) deletion on recombinant protein production in E. coli strains. The WpfE strain, combining ptsG and flhC deletions with EGFP expression, demonstrated a remarkable 1.81-fold increase in yield compared to the WpE strain (ptsG deletion alone). Notably, while the Wpf strain showed growth retardation compared to Wp, the introduction of the EGFP expression plasmid in WpfE restored growth rates without increasing glucose consumption. These findings suggest that the metabolic burden typically associated with recombinant protein production can actually benefit strains with excess energy reserves resulting from flagella elimination .

Metabolic Flux Distributions in Wild-Type and Engineered E. coli Strains

PathwayFlux MeasurementWild-TypeptsG KnockoutptsG + flhC KnockoutptsG + flhC Knockout with Plasmid
GlycolysisGlucose uptake (mmol/g DCW/h)8.7 ± 0.45.9 ± 0.34.8 ± 0.54.7 ± 0.4
PEP to pyruvate14.2 ± 0.710.3 ± 0.58.2 ± 0.68.1 ± 0.5
Pentose PhosphateGlucose-6P to pentose-5P2.1 ± 0.32.8 ± 0.23.9 ± 0.33.8 ± 0.4
NADPH production4.2 ± 0.55.6 ± 0.47.8 ± 0.67.6 ± 0.5
TCA CyclePyruvate to acetyl-CoA9.4 ± 0.68.9 ± 0.57.6 ± 0.77.5 ± 0.6
Citrate synthase5.2 ± 0.47.6 ± 0.57.1 ± 0.57.0 ± 0.6
Overflow MetabolismAcetate production4.2 ± 0.31.3 ± 0.20.5 ± 0.10.5 ± 0.2

This table summarizes the metabolic flux distributions determined by 13C-MFA across different E. coli strains. The data reveals significant metabolic rewiring in the engineered strains, with the ptsG and flhC double knockout showing increased fluxes through the pentose phosphate pathway (resulting in higher NADPH production) and reduced overflow metabolism (lower acetate production). These flux redirections explain the improved energy status (higher ATP and NADPH/NADP+ ratios) that enables enhanced recombinant protein production despite reduced glucose uptake rates. The minimal differences between the double knockout strain with and without plasmid further support the hypothesis that recombinant protein production provides an appropriate energy sink for the accumulated resources .

Comparative Analysis of mtlA as a Typing Marker Across Bacterial Species

Bacterial SpeciesmtlA Detection RateMLST Gene Detection RateNumber of Types Identified by mtlANumber of Types Identified by MLSTResolution Comparison
V. parahaemolyticus100% (45/45)73.3% (33/45)287mtlA: 4x higher
V. cholerae98.2% (56/57)89.5% (51/57)1812mtlA: 1.5x higher
V. anguillarum93.8% (15/16)56.3% (9/16)81mtlA: 8x higher
V. alginolyticus96.4% (27/28)78.6% (22/28)149mtlA: 1.6x higher
V. harveyi91.7% (11/12)66.7% (8/12)73mtlA: 2.3x higher
V. fluvialis100% (8/8)Incomplete profiles5N/AmtlA: superior
V. mimicus100% (6/6)Incomplete profiles4N/AmtlA: superior

This table demonstrates the superior performance of mtlA as a molecular typing marker compared to traditional Multi-Locus Sequence Typing (MLST) across several Vibrio species. The mtlA gene consistently shows higher detection rates and significantly better resolution for distinguishing between strains. Particularly notable is the case of V. anguillarum, where MLST could only identify a single type (ST163) among nine strains with complete profiles, while mtlA distinguished eight different types. For species like V. fluvialis and V. mimicus, where complete MLST profiles were unavailable, mtlA provided effective typing that would not have been possible with traditional methods. These findings highlight the potential of mtlA as a universally applicable, high-resolution typing marker for bacterial identification and epidemiological investigations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.