Recombinant Escherichia coli Putative colanic biosynthesis UDP-glucose lipid carrier transferase (wcaJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly packed with blue ice packs. If dry ice packaging is required, please communicate with us beforehand, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend a brief centrifugation of the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
wcaJ; b2047; JW2032; UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase; UDP-Glc:Und-P Glc-1-P transferase; Colanic acid biosynthesis UDP-glucose lipid carrier transferase; Glucosyl-P-P-undecaprenol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-464
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
wcaJ
Target Protein Sequence
MTNLKKRERAKTNASLISMVQRFSDITIMFAGLWLVCEVSGLSFLYMHLLVALITLVVFQ MLGGITDFYRSWRGVRAATEFALLLQNWTLSVIFSAGLVAFNNDFDTQLKIWLAWYALTS IGLVVCRSCIRIGAGWLRNHGYNKRMVAVAGDLAAGQMLMESFRNQPWLGFEVVGVYHDP KPGGVSNDWAGNLQQLVEDAKAGKIHNVYIAMQMCDGARVKKLVHQLADTTCSVLLIPDV FTFNILHSRLEEMNGVPVVPLYDTPLSGVNRLLKRAEDIVLATLILLLISPVLCCIALAV KLSSPGPVIFRQTRYGMDGKPIKVWKFRSMKVMENDKVVTQATQNDPRVTKVGNFLRRTS LDELPQFINVLTGGMSIVGPRPHAVAHNEQYRQLIEGYMLRHKVKPGITGWAQINGWRGE TDTLEKMEKRVEFDLEYIREWSVWFDIKIVFLTVFKGFVNKAAY
Uniprot No.

Target Background

Function
This enzyme initiates colanic acid (CA) synthesis. It catalyzes the transfer of the glucose-1-phosphate moiety from UDP-Glc onto the carrier lipid undecaprenyl phosphate (C55-P), forming a phosphoanhydride bond that yields glucosyl-pyrophosphoryl-undecaprenol (Glc-PP-C55). This enzyme also exhibits a weak galactose-1-P transferase activity.
Database Links
Protein Families
Bacterial sugar transferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is WcaJ and what is its primary function in E. coli?

WcaJ is a membrane enzyme in Escherichia coli that catalyzes the biosynthesis of undecaprenyl-diphosphate-glucose, which serves as the first step in the assembly of colanic acid exopolysaccharide . This enzyme functions as a UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase, forming a phosphoanhydride bond between the 1-phosphate residue of undecaprenyl-phosphate (Und-P) and glucose-1-phosphate, resulting in the release of UMP . The reaction catalyzed by WcaJ is crucial as it initiates the synthesis pathway of colanic acid, an extracellular polysaccharide found in Enterobacteriaceae that contributes to biofilm formation and bacterial survival under stressful conditions .

What is the substrate specificity of WcaJ?

In vitro transferase assays have demonstrated that WcaJ specifically utilizes UDP-glucose but not UDP-galactose as its substrate . This specificity is critical for its function in initiating colanic acid synthesis by transferring α-D-glucose-1-phosphate to undecaprenyl phosphate . The enzyme's ability to discriminate between these closely related UDP-sugars highlights the precision of substrate recognition in the PHPT family. Complementation studies have further confirmed this specificity, showing that WcaJ can restore colanic acid production in E. coli K-12 wcaJ mutants .

How is colanic acid biosynthesis regulated in E. coli?

Colanic acid biosynthesis in E. coli is linked to a cluster of 19 genes named wca, with WcaJ playing a crucial role in the initiation step . This biosynthetic pathway is tightly regulated by a complex signal transduction cascade governed by the rcs (regulator of capsule synthesis) phosphorelay system . The assembled colanic acid polysaccharide repeat is initially built on the membrane lipid all-trans-dodecaprenyl diphosphate by a series of glycosyl transferases on the cytoplasmic face of the inner membrane. Subsequently, the single repeat is flipped to the periplasmic side and polymerized by the Wzy-dependent pathway . The polymer is then believed to be cleaved from the all-trans-dodecaprenyl diphosphate anchor, transported across the periplasm, and excreted into the extracellular space, although this process is not fully understood .

What experimental approaches are most effective for determining the membrane topology of WcaJ?

Determining the membrane topology of WcaJ requires a combination of complementary experimental approaches to overcome the limitations of individual methods. An effective strategy includes:

  • Reporter fusion analysis: Create a series of LacZ/PhoA reporter fusions at different positions along the WcaJ sequence. LacZ is active in the cytoplasm while PhoA is active in the periplasm, allowing for the determination of the subcellular localization of specific protein regions . This approach provides initial insights into the general topology but may be affected by the large size of the reporter proteins.

  • Sulfhydryl labeling by PEGylation: Introduce single cysteine residues at strategic positions in a cysteine-less version of WcaJ, followed by labeling with membrane-permeable and membrane-impermeable sulfhydryl reagents . This approach provides more precise information about the accessibility of specific residues from either side of the membrane.

  • Protease accessibility assays: Use compartment-specific proteases to digest exposed regions of the protein, followed by immunoblotting with antibodies against different epitopes in WcaJ.

  • Molecular dynamics simulations: Complement experimental data with computational modeling of TMH regions, particularly for unusual structures like the TMH-V "hairpin" in WcaJ .

The combination of these approaches revealed that both the large central loop and the C-terminal tail of WcaJ reside in the cytoplasm, contradicting the previously predicted topology . The fifth transmembrane helix (TMH-V) was found to form an unusual "hairpin" structure rather than fully spanning the membrane .

How does the unique "hairpin" structure of TMH-V contribute to WcaJ function?

The unusual "hairpin" structure formed by TMH-V in WcaJ has significant implications for its enzymatic function:

  • Positioning of catalytic domains: The hairpin structure ensures that both the large central domain and the C-terminal domain, which contain catalytic residues, are positioned in the cytoplasm where they can access the UDP-glucose substrate . This arrangement is crucial for the enzyme's activity in transferring glucose-1-phosphate to undecaprenyl phosphate.

  • Conserved proline contribution: Molecular modeling of TMH-V revealed that a highly conserved proline residue likely contributes to the helix-break-helix structure observed in WcaJ and is predicted to be present in all PHPT family members . This proline may act as a helix breaker, facilitating the formation of the hairpin structure.

  • Membrane association: The hairpin structure allows for increased interaction with the membrane while maintaining catalytic domains in the cytoplasm. This may facilitate access to the membrane-embedded undecaprenyl phosphate substrate.

  • Evolutionary conservation: Bioinformatic analyses suggest that this unusual topological configuration is conserved in PHPT homologues from both Gram-negative and Gram-positive bacteria, indicating its functional importance .

This unique topology challenges the traditional model of transmembrane proteins and suggests a specialized structural adaptation that optimizes the enzyme's function in synthesizing undecaprenyl-diphosphate-glucose at the cytoplasmic membrane interface.

What methodologies can be used to assess WcaJ enzymatic activity in vitro?

Assessing WcaJ enzymatic activity in vitro requires careful consideration of its membrane-associated nature and specific substrate requirements. Effective methodologies include:

  • Radiolabeled substrate incorporation assay: Using UDP-[14C]glucose to monitor the transfer of radiolabeled glucose-1-phosphate to undecaprenyl phosphate . The reaction products can be separated by thin-layer chromatography and quantified by scintillation counting.

  • Membrane fraction preparation: Isolate membrane fractions containing WcaJ from recombinant E. coli strains expressing the protein. This requires:

    • Cell disruption by French press or sonication

    • Differential centrifugation to isolate membrane fractions

    • Solubilization of membrane proteins using appropriate detergents that maintain enzyme activity

  • Continuous spectrophotometric assay: Coupling the release of UMP during the transferase reaction to a secondary enzyme system that produces a spectrophotometrically detectable signal.

  • High-performance liquid chromatography (HPLC): Analyzing reaction products by HPLC to directly quantify the formation of undecaprenyl-diphosphate-glucose.

  • Mass spectrometry: Identifying reaction products by liquid chromatography-mass spectrometry (LC-MS) to confirm their chemical structure.

These methodologies have demonstrated that WcaJ specifically utilizes UDP-glucose but not UDP-galactose, confirming its role as a UDP-Glc:Und-P Glc-1-P transferase .

What are the key functional differences between WcaJ and other members of the PHPT family?

The PHPT family includes several enzymes with similar catalytic functions but different substrate specificities and biological roles. Key functional differences include:

PHPT Family MemberOrganismSubstrate SpecificityBiological FunctionComplementation Ability
WcaJEscherichia coliUDP-glucoseInitiates colanic acid synthesisCan complement C. crescentus holdfast synthesis
PssYCaulobacter crescentusUDP-glucoseInvolved in holdfast polysaccharide synthesisCan complement E. coli colanic acid synthesis
PssZCaulobacter crescentusNot fully characterizedInvolved in holdfast polysaccharide synthesisNot demonstrated
HfsECaulobacter crescentusNot fully characterizedInvolved in holdfast polysaccharide synthesisNot demonstrated

While WcaJ and PssY both utilize UDP-glucose and can functionally complement each other's roles in their respective organisms, suggesting similar catalytic mechanisms, other members of the family may have evolved different substrate specificities or regulatory properties . The ability of these enzymes to complement each other across different bacterial species highlights the conservation of the basic catalytic mechanism despite differences in their native cellular contexts.

What are the optimal conditions for expressing recombinant WcaJ in E. coli?

Expressing functionally active recombinant WcaJ in E. coli requires careful optimization of expression conditions due to its membrane-associated nature:

  • Expression system selection:

    • Use E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Consider using a wcaJ-deficient strain to avoid interference from endogenous protein

  • Expression vector optimization:

    • Include a C-terminal or N-terminal affinity tag (His6 or FLAG) for purification

    • Use an inducible promoter system (e.g., T7 or arabinose-inducible) for controlled expression

    • Consider including a fusion partner that enhances membrane protein folding

  • Induction conditions:

    • Lower induction temperature (16-25°C) to reduce inclusion body formation

    • Reduced inducer concentration to slow protein synthesis

    • Extended expression time (overnight) at lower temperatures

  • Media and growth conditions:

    • Rich media supplemented with glucose for biomass accumulation

    • Shift to induction media lacking glucose when inducing with IPTG

    • Maintain appropriate aeration during growth and expression phases

  • Verification of functional expression:

    • Western blot analysis to confirm protein expression

    • Complementation assays in wcaJ-deficient strains to verify functionality

    • In vitro activity assays using membrane fractions

This optimized approach has been successfully used to express functional WcaJ for both in vivo complementation studies and in vitro enzymatic characterization .

How can researchers troubleshoot issues in WcaJ purification and activity assays?

Purification of membrane proteins like WcaJ presents numerous challenges. Here are methodological approaches to troubleshoot common issues:

  • Low protein yield:

    • Optimize expression conditions as detailed in section 3.1

    • Screen different detergents for efficient solubilization (e.g., DDM, LDAO, CHAPS)

    • Consider using a GFP fusion to monitor expression and purification efficiency

    • Test partial purification using membrane fractions rather than complete purification

  • Loss of activity during purification:

    • Maintain low temperature (4°C) throughout purification

    • Include glycerol (10-20%) in all buffers to stabilize the protein

    • Add phospholipids to purification buffers to maintain a lipid-like environment

    • Consider using mild detergents or nanodiscs to preserve the native membrane environment

  • Inconsistent activity assay results:

    • Ensure proper preparation of undecaprenyl phosphate substrate (sonication may be required)

    • Verify UDP-glucose quality and prepare fresh stocks

    • Optimize reaction conditions (pH, temperature, divalent cations)

    • Include positive controls with membrane fractions of known activity

  • Protein aggregation:

    • Screen additional detergents or detergent combinations

    • Add specific lipids that may stabilize the protein

    • Consider using styrene maleic acid lipid particles (SMALPs) to extract the protein with its native lipid environment

  • Troubleshooting methodology for activity assays:

    • Validate assay components individually

    • Perform time-course experiments to establish linearity

    • Vary enzyme concentration to confirm dose-dependency

    • Test both radiochemical and coupled enzyme assays to cross-validate results

These troubleshooting approaches address the specific challenges of working with WcaJ as a membrane-associated enzyme and can significantly improve the reliability of structural and functional studies .

What methods can be used to study the structure-function relationship of WcaJ?

Understanding the structure-function relationship of WcaJ requires a multifaceted approach combining various techniques:

  • Site-directed mutagenesis:

    • Target conserved residues identified through sequence alignment of PHPT family members

    • Focus on the conserved proline in TMH-V that contributes to the hairpin structure

    • Systematically mutate residues in the cytoplasmic domains to identify those involved in substrate binding or catalysis

    • Assess the effect of mutations on enzyme activity and protein topology

  • Chimeric protein construction:

    • Create chimeric proteins between WcaJ and other PHPT family members (e.g., PssY)

    • Swap domains between proteins to identify regions responsible for substrate specificity

    • Test complementation ability of chimeric proteins in appropriate mutant strains

  • Structural biology approaches:

    • Cryo-electron microscopy of WcaJ reconstituted in nanodiscs or SMALPs

    • X-ray crystallography of soluble domains or stabilized full-length protein

    • Nuclear magnetic resonance (NMR) spectroscopy of isotopically labeled protein fragments

  • Molecular dynamics simulations:

    • Simulate the behavior of TMH-V in a lipid bilayer to understand hairpin formation

    • Model substrate binding and catalysis based on structural data

    • Predict the effects of mutations on protein structure and function

  • Functional complementation assays:

    • Test the ability of mutated or chimeric proteins to restore colanic acid production in wcaJ-deficient E. coli strains

    • Quantify the level of complementation through colanic acid production assays

  • In vitro activity assays:

    • Compare kinetic parameters (Km, Vmax) of wild-type and mutant proteins

    • Assess the effect of mutations on substrate specificity

This integrated approach has revealed the unexpected topology of WcaJ and identified key structural features such as the TMH-V hairpin that are likely shared among all members of the PHPT family .

How can genetic engineering of WcaJ be used to modify colanic acid production in E. coli?

Genetic engineering of WcaJ offers several strategies to modify colanic acid production, with potential applications in biotechnology and bacterial physiology research:

These approaches could lead to the development of E. coli strains with enhanced exopolysaccharide production for industrial applications or modified surface properties for biomedical applications .

What is the evolutionary significance of the conserved topology in the PHPT family?

The unexpected membrane topology of WcaJ, with both the large central loop and C-terminal tail residing in the cytoplasm separated by a TMH-V "hairpin" structure, has significant evolutionary implications:

  • Functional constraints driving conservation:

    • The conserved topology suggests strong functional constraints on PHPT family enzymes

    • Positioning of both substrate-binding domains in the cytoplasm optimizes access to UDP-sugar substrates

    • The hairpin structure may provide an optimal interface for interaction with the membrane-embedded undecaprenyl phosphate

  • Role of the conserved proline in TMH-V:

    • The highly conserved proline likely contributes to the helix-break-helix structure in all PHPT members

    • This structural feature may represent a specialized adaptation for membrane-associated glycosyltransferases

    • The conservation of this feature across diverse bacterial species suggests its early emergence in bacterial evolution

  • Implications for enzyme mechanism:

    • The conserved topology may facilitate a common catalytic mechanism across the PHPT family

    • The ability of WcaJ and PssY to complement each other functionally despite evolutionary distance supports this hypothesis

  • Methodological approaches to study evolutionary conservation:

    • Phylogenetic analysis of PHPT family members across bacterial species

    • Structure-based sequence alignments focusing on the TMH-V region

    • Functional complementation studies with PHPT members from diverse bacterial species

    • Ancestral sequence reconstruction to infer the properties of ancestral PHPT enzymes

Bioinformatic analyses have shown that the unusual topological configuration of WcaJ is likely present in PHPT homologues from both Gram-negative and Gram-positive bacteria, suggesting that this structural feature emerged early in bacterial evolution and has been maintained due to its functional importance .

What are the current challenges and future directions in understanding WcaJ catalytic mechanism?

Despite significant advances in understanding WcaJ structure and function, several challenges remain in elucidating its precise catalytic mechanism:

  • Current challenges:

    • Lack of high-resolution structural data for the complete WcaJ protein

    • Difficulty in reconstituting the membrane environment for functional studies

    • Complexity of the undecaprenyl phosphate substrate preparation and handling

    • Limited understanding of how the hairpin structure influences catalysis

  • Methodological approaches to address these challenges:

    • Application of advanced structural biology techniques for membrane proteins

    • Development of synthetic undecaprenyl phosphate analogs with improved handling properties

    • Creation of nanodiscs or other membrane mimetics to study WcaJ in a near-native environment

    • Use of hydrogen-deuterium exchange mass spectrometry to identify dynamic regions involved in catalysis

  • Future research directions:

    • Structural studies: Determination of WcaJ structure in complex with substrates or substrate analogs to identify the binding sites and catalytic residues

    • Reaction mechanism: Investigation of the transfer reaction through transient kinetic studies and computational approaches

    • Regulatory mechanisms: Exploration of how WcaJ activity is regulated in response to environmental signals

    • Interaction partners: Identification of protein-protein interactions that may influence WcaJ localization or activity

    • Therapeutic targeting: Exploration of WcaJ as a potential target for antimicrobial development, given its role in biofilm formation

  • Potential applications of mechanistic insights:

    • Design of inhibitors targeting WcaJ to disrupt biofilm formation

    • Engineering of WcaJ variants with altered substrate specificity for biotechnological applications

    • Development of biosensors based on WcaJ activity

Addressing these challenges will require interdisciplinary approaches combining structural biology, enzymology, synthetic chemistry, and computational modeling to fully elucidate the catalytic mechanism of this important enzyme .

What are the key takeaways from current research on WcaJ?

Current research on WcaJ has revealed several important insights with significant implications for our understanding of bacterial polysaccharide biosynthesis:

  • WcaJ functions as a UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase, initiating colanic acid synthesis in E. coli by transferring α-D-glucose-1-phosphate to undecaprenyl phosphate .

  • WcaJ exhibits an unexpected membrane topology where both the large central loop and the C-terminal tail reside in the cytoplasm, separated by a TMH-V that forms a "hairpin" structure rather than fully spanning the membrane .

  • This unique topological configuration is proposed as a signature for all members of the PHPT enzyme family, as suggested by bioinformatic analyses showing conservation in PHPT homologues from both Gram-negative and Gram-positive bacteria .

  • WcaJ and the C. crescentus PssY enzyme can functionally complement each other in colanic acid and holdfast production, respectively, suggesting a conserved catalytic mechanism despite differences in their native cellular contexts .

  • The colanic acid biosynthesis pathway initiated by WcaJ is tightly regulated by the rcs phosphorelay system, highlighting the importance of controlled exopolysaccharide production in bacterial physiology .

These findings have broadened our understanding of membrane protein topology, enzyme evolution, and the mechanisms of bacterial polysaccharide synthesis, providing a foundation for future research in these areas.

How might understanding WcaJ function contribute to broader research fields?

The insights gained from studying WcaJ have implications that extend beyond its specific role in colanic acid biosynthesis:

  • Membrane protein topology models: The unexpected topology of WcaJ challenges traditional models of membrane protein structure and may inform the study of other membrane-associated enzymes .

  • Bacterial physiology: Understanding WcaJ function contributes to our knowledge of how bacteria regulate surface polysaccharide production in response to environmental conditions .

  • Biofilm research: Colanic acid contributes to biofilm formation in E. coli, making WcaJ research relevant to understanding bacterial persistence and antibiotic resistance .

  • Evolutionary biochemistry: The conservation of the unique topological features of WcaJ across diverse bacterial species provides insights into the evolution of membrane-associated glycosyltransferases .

  • Antimicrobial development: Targeting the initiation of exopolysaccharide biosynthesis represents a potential strategy for disrupting biofilm formation, making WcaJ a potential target for novel antimicrobial approaches.

  • Synthetic biology applications: Engineering WcaJ and related enzymes could enable the production of modified exopolysaccharides with novel properties for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.