Recombinant Escherichia coli Putative electron transport protein yccM (yccM)

Shipped with Ice Packs
In Stock

Description

Functional Role in Electron Transport

YccM facilitates electron transfer to periplasmic nitrate reductase (NapA), a critical enzyme in anaerobic respiration . Experimental studies suggest it aids in the maturation of NapA prior to its export to the periplasm . Key functional attributes include:

  • Electron Carrier: Acts as a ferredoxin-type protein, shuttling electrons to redox partners.

  • Metabolic Context: Operates in pathways linked to nitrate reduction and anaerobic respiration .

Protein Interactions and Pathways

YccM interacts with multiple proteins involved in redox processes (Table 1) :

Interacting ProteinFunctionInteraction Score
NapFElectron transfer to periplasmic nitrate reductase NapA0.759
HcpHydroxylamine reduction to ammonia0.729
HcrNADH-dependent oxidoreductase acting with Hcp0.687
PfoPyruvate-to-flavodoxin electron transfer0.650

These interactions position YccM within a network supporting anaerobic metabolism and stress response .

Biotechnological Production and Applications

Recombinant YccM is commercially available for research purposes, with specifications optimized for experimental reproducibility (Table 2) :

ParameterDetail
Expression SystemE. coli with N-terminal His tag
Purity>90% (SDS-PAGE verified)
Storage-20°C/-80°C in Tris/PBS buffer with 50% glycerol
ApplicationsEnzyme kinetics studies, protein interaction assays, structural biology

Research Implications

  • Electron Transport Mechanisms: YccM’s role in NapA maturation highlights its importance in bacterial anaerobic respiration .

  • Biochemical Tool: Recombinant YccM serves as a model for studying 4Fe-4S cluster proteins and membrane-associated electron carriers .

  • Bioremediation Potential: Its involvement in nitrate reduction pathways suggests applications in wastewater treatment or environmental engineering .

Unresolved Questions

  • MOSC Domain Function: While YccM contains a MOSC domain, its exact role in molybdenum cofactor (MoCo) binding or sulfuration remains uncharacterized .

  • Regulatory Mechanisms: The protein’s expression dynamics under varying metabolic conditions (e.g., oxygen availability) warrant further study .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we are happy to accommodate specific format requests. Please clearly indicate your preferred format when placing your order and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery time information.
Note: Our standard shipping includes blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference for your own protocols.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please let us know and we will prioritize its inclusion in the manufacturing process.
Synonyms
yccM; b0992; JW0977; Putative electron transport protein YccM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yccM
Target Protein Sequence
MAENKRTRWQRRPGTTGGKLPWNDWRNATTWRKATQLLLLAMNIYIAITFWYWVRYYETA SSTTFVARPGGIEGWLPIAGLMNLKYSLVTGQLPSVHAAAMLLLVAFIVISLLLKKAFCS WLCPVGTLSELIGDLGNKLFGRQCVLPRWLDIPLRGVKYLLLSFFIYIALLMPAQAIHYF MLSPYSVVMDVKMLDFFRHMGTATLISVTVLLIASLFIRHAWCRYLCPYGALMGVVSLLS PFKIRRNAESCIDCGKCAKNCPSRIPVDKLIQVRTVECTGCMTCVESCPVASTLTFSLQK PAANKKAFALSGWLMTLLVLGIMFAVIGYAMYAGVWQSPVPEELYRRLIPQAPMIGH
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of YccM protein?

YccM is predicted to be an inner membrane protein with five transmembrane domains. Experimental topology analysis suggests the C terminus is located in the inner membrane . The protein is encoded by the yccM gene (b0992, ECK0983) in E. coli K-12 substr. MG1655 and comprises 357 amino acids from a 1074 bp gene . YccM is also identified as a "putative 4Fe-4S membrane protein," suggesting it may contain iron-sulfur clusters that could participate in redox reactions, though detailed structural studies confirming this feature are not evident in the current literature.

What is known about YccM's function in bacterial physiology?

  • Gene knockout studies to observe phenotypic changes

  • Protein-protein interaction analyses to identify functional partners

  • Comparative genomics with known electron transport components

  • Biochemical assays measuring electron transfer capabilities

  • Expression studies under different growth conditions to identify functional contexts

What are effective strategies for recombinant expression of YccM?

As a membrane protein with multiple transmembrane domains, YccM presents typical challenges for recombinant expression. Researchers should consider:

Expression system optimization:

  • Testing E. coli strains specifically designed for membrane protein expression (C41/C43)

  • Employing low-temperature induction protocols to minimize inclusion body formation

  • Using strictly controlled expression systems (PBAD, pRha) to prevent toxicity

  • Incorporating fusion partners that enhance membrane insertion and folding

Expression validation techniques:

  • Western blotting with tag-specific antibodies

  • Membrane fraction analysis

  • Fluorescent protein fusions for localization confirmation

What purification approaches maintain YccM structural integrity?

Membrane protein purification requires specialized methodologies:

  • Membrane isolation using differential centrifugation

  • Careful detergent screening (starting with mild detergents like DDM or LMNG)

  • Affinity chromatography using appropriate tags

  • Size exclusion chromatography for final purification

  • Validation of structural integrity through circular dichroism or limited proteolysis

  • Activity assays to confirm functional state

How can researchers address common challenges in YccM functional studies?

When studying putative electron transport proteins like YccM, researchers often encounter:

Challenge: Protein instability

  • Solution: Screen buffer conditions with varying pH, salt concentration, and additives like glycerol or specific lipids

  • Validation: Thermal shift assays to identify stabilizing conditions

Challenge: Low expression yields

  • Solution: Optimize codon usage, test different fusion partners, and evaluate expression at various temperatures

  • Validation: Quantitative western blotting against standards

Challenge: Assessing electron transport activity

  • Solution: Develop in vitro reconstitution systems with potential electron donors/acceptors

  • Validation: Spectroscopic methods to monitor redox state changes

How should researchers design experiments to elucidate YccM's role in electron transport?

A comprehensive approach would include:

  • Genetic manipulation studies:

    • Gene deletion using CRISPR-Cas9 or λ Red recombineering

    • Complementation analysis with wild-type and mutant variants

    • Phenotypic characterization under various respiratory conditions

  • Biochemical analyses:

    • Redox potential determination

    • Identification of potential electron donors and acceptors

    • Assessment of iron-sulfur cluster content and properties

  • Systems biology approaches:

    • Transcriptomic analysis comparing wild-type and ΔyccM strains

    • Metabolomic profiling to identify affected pathways

    • Proteomic analysis to identify altered protein expression or modifications

What methods can determine YccM's interaction with other membrane components?

Understanding protein-protein interactions is crucial for elucidating YccM function:

In vivo approaches:

  • Bacterial two-hybrid systems adapted for membrane proteins

  • Förster resonance energy transfer (FRET) with fluorescently tagged proteins

  • In vivo crosslinking followed by mass spectrometry

In vitro methods:

  • Co-immunoprecipitation using affinity tags

  • Surface plasmon resonance with purified components

  • Native mass spectrometry of membrane protein complexes

How can researchers investigate potential relationships between YccM and other E. coli proteins?

Based on the literature about other E. coli proteins like YccT (CsgI) and YciM, researchers might explore:

  • Whether YccM influences biofilm formation processes regulated by CsgI

  • Potential coordination between YccM and the OmpR/EnvZ two-component system involved in curli expression

  • Possible functional relationships with lipopolysaccharide biosynthesis, which involves YciM

  • Effects of YccM expression on endotoxin levels in recombinant protein preparations

How might YccM function relate to biofilm formation mechanisms?

While direct evidence linking YccM to biofilm formation is not present in the search results, researchers might investigate:

  • Whether YccM deletion affects curli fimbriae formation, which is critical for biofilm development

  • Potential interactions with the EnvZ/OmpR regulatory system that modulates curli synthesis

  • Comparative expression analysis of yccM during planktonic growth versus biofilm conditions

  • YccM's potential role in electron transport during the transition to the biofilm state

The research approach could draw insights from studies of CsgI (YccT), which has been identified as an inhibitor of curli fimbriae formation in E. coli and functions as both an OmpR phosphorylation modulator and CsgA polymerization inhibitor .

What bioinformatic approaches can predict YccM functional relationships?

Advanced computational methods to investigate YccM include:

Sequence-based analyses:

  • Multiple sequence alignment of YccM homologs to identify conserved residues

  • Phylogenetic profiling to identify proteins with similar evolutionary patterns

  • Gene neighborhood analysis to identify functionally related genes

Structure-based predictions:

  • Homology modeling based on related proteins with known structures

  • Molecular docking to predict interaction partners

  • Molecular dynamics simulations to understand membrane integration

Data integration approaches:

  • Network analysis incorporating transcriptomic data

  • Machine learning models predicting protein function from multiple data types

  • Text mining of scientific literature for related functional information

How might YccM research contribute to reducing endotoxin contamination in recombinant protein production?

Research on YciM has demonstrated that its overexpression reduces lipopolysaccharide levels in E. coli, resulting in decreased endotoxin contamination of purified recombinant proteins . Researchers might investigate:

  • Whether YccM expression levels correlate with endotoxin production

  • Potential functional relationships between YccM and YciM in membrane biogenesis

  • Development of expression strains with optimized YccM expression for recombinant protein production

  • Comparative analysis of endotoxin levels in wild-type versus YccM-modified strains

This research direction could build upon findings that increased YciM expression reduces LpxC enzyme levels involved in LPS biosynthesis, providing an alternative approach to traditional gene knockout methods for reducing endotoxin contamination .

How does YccM compare to other electron transport proteins in E. coli?

A comprehensive comparative analysis would include:

FeatureYccMOther E. coli Electron Transport Proteins
Membrane localizationInner membrane Various (inner membrane, periplasm)
Number of transmembrane domainsFive predicted Variable depending on protein family
CofactorsPredicted 4Fe-4S clusters Heme, Fe-S clusters, flavins, quinones
Gene regulationNot fully characterizedOften regulated by oxygen availability
Functional redundancyUnknownCommon in electron transport chains

Research methodology would involve systematic comparison of sequence motifs, structural features, and functional assays across the electron transport proteome.

What evolutionary insights might YccM research provide?

Evolutionary analysis of YccM could:

  • Establish conservation patterns across bacterial species

  • Identify potential horizontal gene transfer events

  • Reveal adaptive changes in different ecological niches

  • Provide insights into the evolution of bacterial electron transport systems

  • Identify selection pressures on specific protein domains

Such research might employ molecular clock analyses, positive selection detection algorithms, and ancestral sequence reconstruction methods.

How might YccM relate to antimicrobial resistance mechanisms?

Given the importance of membrane proteins in bacterial physiology and drug resistance, researchers might investigate:

  • Whether YccM expression changes in response to antimicrobial exposure

  • Potential roles in maintaining membrane potential during antibiotic stress

  • Interactions with known resistance determinants like efflux pumps

  • Comparative expression in resistant versus susceptible strains

This research could build on findings related to other E. coli membrane proteins and their roles in antimicrobial resistance, such as the mcr-1 gene that confers colistin resistance and is associated with various plasmid types in clinical isolates .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.