Recombinant Escherichia coli Putative ferric transport system permease protein fbpB (fbpB)

Shipped with Ice Packs
In Stock

Description

Protein Identity and Basic Properties

The putative ferric transport system permease protein FbpB is encoded by the fbpB gene in Escherichia coli. This protein is part of the ABC transporter family and functions specifically as a membrane permease component within the FbpABC transport system. FbpB is also known by the alternative name afuB in the scientific literature . The protein is characterized as a polytopic transmembrane protein, estimated to be approximately 500 amino acids in length, though commercial recombinant versions may be available as partial proteins .

Solubility Characteristics

According to solubility prediction analyses, FbpB demonstrates relatively high solubility compared to other bacterial proteins. Using the Protein-Sol web server, which calculates sequence-based properties using data for protein solubility of E. coli in cell-free expression systems, FbpB was predicted to have a solubility value of 0.509 . This value exceeds the average solubility of E. coli proteins (0.45), suggesting that FbpB has higher solubility than typical soluble E. coli proteins .

The FbpABC Transport System

The FbpABC transporter functions as a binding protein-dependent ABC transporter that shuttles free Fe³⁺ through the periplasm and across the inner membrane of bacteria . This system comprises three main components:

  1. FbpA: A periplasmic ferric ion-binding protein

  2. FbpB: The inner membrane permease

  3. FbpC: An ATP-binding protein that provides energy for transport

Together, these components facilitate the transport of naked (free) Fe³⁺ from the periplasm to the cytosol in an ATP-dependent manner .

Mechanism of Iron Transport

In bacterial species that utilize siderophore-independent iron transport systems, such as certain strains of Haemophilus influenzae and potentially some E. coli strains, the FbpABC transporter plays a crucial role in iron acquisition. Initially, iron bound to host proteins like transferrin or lactoferrin is extracted and transported across the outer membrane by specific receptor complexes (TbpA/TbpB or LbpA/LbpB) . Subsequently, the released Fe³⁺ is bound by FbpA in the periplasm and then transported across the inner membrane via the FbpB permease, with the process energized by ATP hydrolysis catalyzed by FbpC .

The FbpB permease is proposed to function both as a receptor for FbpA and as a channel for the passage of Fe³⁺ . A critical event during the transport process is the exchange of Fe³⁺ from FbpA to the FbpB permease prior to transport across the inner membrane.

Expression and Purification

The recombinant production of FbpB presents considerable challenges due to its highly hydrophobic nature and potential toxicity when expressed from recombinant sources . Commercial sources offer recombinant E. coli putative ferric transport system permease protein FbpB with greater than 85% purity as determined by SDS-PAGE analysis . These recombinant proteins are typically produced in E. coli expression systems.

Reconstitution Recommendations

For optimal use of recombinant FbpB, proper reconstitution procedures should be followed. The recommended protocol includes:

  1. Brief centrifugation of the vial prior to opening

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of 5-50% glycerol (final concentration) for long-term storage

  4. Aliquoting for storage at -20°C/-80°C

The default final concentration of glycerol used in commercial preparations is typically 50% .

Comparison with Other Bacterial Iron Transport Systems

The FbpABC system in E. coli shares functional similarities with iron transport systems in other bacteria. In contrast to siderophore-dependent iron acquisition mechanisms, such as the ferric enterobactin transport system also found in E. coli, the FbpABC system represents a siderophore-independent approach to iron acquisition .

The ferric enterobactin transport system in E. coli involves the outer membrane protein FepA, which binds ferric enterobactin and transports it to the periplasm . A soluble periplasmic protein, FepB, then binds the ferric siderophore and facilitates its transfer to a multisubunit inner membrane permease, FepCDG . This transport mechanism requires ATP hydrolysis, similar to the FbpABC system.

FbpB in Different Bacterial Species

While FbpB has been characterized in E. coli, homologous proteins exist in other bacterial species. In Haemophilus influenzae, the hFbpABC transporter functions as a binding protein-dependent ABC transporter that shuttles free Fe³⁺ through the periplasm and across the inner membrane . The FbpB homologs in different species possess the conserved permease motifs typical of bacterial ABC transporter permeases, suggesting similar functional mechanisms across species .

Biotechnological Applications

The unique properties of FbpB make it a potential target for various biotechnological applications. Recent research has explored the use of heterologous expression systems to enhance protein solubility and functionality. For instance, controlling environmental conditions, particularly culture temperature, has been shown to suppress inclusion body formation and enhance protein functionality in recombinant expression systems .

Role in CO₂ Recycling Systems

Interestingly, FbpB has been mentioned in studies investigating CO₂ recycling in modified E. coli strains containing Calvin-Benson-Bassham (CBB) cycle genes . These studies have found that environmental conditions, particularly culture temperature, can influence inclusion body formation and CO₂ recycling capacity in such systems. FbpB's relatively high predicted solubility may contribute to its potential utility in these applications .

Challenges and Future Research Directions

Despite advances in understanding FbpB structure and function, several challenges remain. The highly hydrophobic nature of the protein continues to pose difficulties for structural characterization and functional studies . Future research directions may include:

  1. Detailed structural studies using advanced techniques such as cryo-electron microscopy

  2. Investigation of protein-protein interactions within the FbpABC complex

  3. Exploration of the specific role of FbpB in iron transport kinetics

  4. Development of optimized expression systems for efficient recombinant production

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
afuB; fbpB; b0263; JW0255; Putative ferric transport system permease-like protein AfuB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
afuB
Target Protein Sequence
GQIDKSLDEASLSLRAGSLRTITHILLPLLRPAILSALIYSFVRAITTVSAIVFLVTPDT RVATAYILNRVEDGEYGVAIAYGSILIVVMLAIIFIFDWLIGESRTSRSKAKNQA
Uniprot No.

Target Background

Function
A severely truncated paralog of the AfuB uptake protein, homologous only to the last 20% of the intact protein in Actinobacillus.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, FbpB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of FbpB in bacterial iron acquisition pathways?

FbpB functions as a permease component of ATP-binding cassette (ABC) transporters involved in iron uptake. In systems like those found in Neisseria gonorrhoeae, the FbpB protein serves as a cytoplasmic membrane permease that works in conjunction with FbpA (a periplasmic iron-binding protein) and FbpC (a nucleotide-binding domain with ATPase activity) to transport iron from the periplasm to the cytosol . This system enables bacteria to acquire iron, an essential nutrient for survival and virulence. The fbpABC operon encodes this complete transport system, with each component playing a specialized role in the iron uptake process.

While direct evidence for E. coli FbpB function is limited in the provided search results, comparison with related systems suggests it likely functions as the transmembrane component that creates a pathway for iron to cross the cytoplasmic membrane following its capture by periplasmic binding proteins. This function is essential for bacterial growth under iron-limited conditions that would typically be encountered during infection of a host organism.

How does FbpB differ structurally and functionally from other bacterial iron transport permeases?

FbpB belongs to a family of permease proteins that function in ABC transporter systems. When comparing different bacterial iron transport systems, we observe important distinctions in structure and substrate specificity. For instance, in E. coli, the FepB system represents a well-characterized periplasmic protein involved in the uptake of iron complexed with enterobactin . Unlike FbpB systems that typically transport free iron or iron from host iron-binding proteins, FepB specifically binds ferrienterobactin (FeEnt).

The structural differences between these systems reflect their specialized functions. The BfpB protein in E. coli, while not directly related to iron transport, demonstrates how similar naming can represent entirely different functions - BfpB forms a ring-shaped, high-molecular-weight outer-membrane complex involved in pilus biogenesis and protein secretion . This highlights the importance of carefully distinguishing between similarly named bacterial proteins.

From research on related systems, we can infer that FbpB likely contains multiple transmembrane domains that form a channel through which iron can pass. These structural features are typically conserved among permease components of ABC transporters despite variations in substrate specificity.

What experimental evidence supports the classification of FbpB as a ferric transport system permease?

The classification of FbpB as a ferric transport system permease is supported by several lines of experimental evidence observed in related bacterial systems. In N. gonorrhoeae, the entire fbpABC operon was shown to function as an iron transport system at the periplasm-to-cytosol level when expressed in siderophore-deficient E. coli strains. These transformed strains were able to grow on nutrient agar containing an inhibitory concentration of 2,2′-dipyridyl, an iron chelator, demonstrating the operon's functionality in iron transport .

Further evidence comes from the detection of fbpAB and fbpBC transcripts in Neisseria meningitidis using reverse transcription-PCR, suggesting that the fbpABC locus is transcribed as a single contiguous message . The complementary functions of FbpA, FbpB, and FbpC in forming a complete transport system provide strong support for FbpB's role as the permease component.

For researchers studying E. coli FbpB specifically, similar functional analyses would be necessary to confirm its role in iron transport. This could include complementation studies, growth assays under iron-limited conditions, and direct measurement of iron uptake in wildtype versus fbpB mutant strains.

What are the most effective methods for expressing recombinant FbpB protein in E. coli systems?

For effective expression of recombinant FbpB protein in E. coli systems, researchers should consider several methodological approaches. Based on related protein expression systems, a recommended approach includes:

  • Vector selection: pET expression vectors, particularly pET-30a, have been successfully used for similar proteins . These vectors provide strong T7 promoter-driven expression and allow for the addition of affinity tags.

  • E. coli strain selection: BL21(DE3) strain is particularly suitable for membrane protein expression due to its reduced protease activity and compatibility with T7 promoter-based expression systems .

  • Induction conditions: Optimization of IPTG concentration (typically 0.5-1.0 mM), temperature (often lowered to 16-25°C for membrane proteins), and induction time (4-16 hours) is critical for maximizing functional protein yield.

  • Fusion tags: Addition of an N-terminal HIS-tag facilitates purification and detection while minimizing interference with protein function . For membrane proteins like FbpB, careful placement of tags is essential to avoid disrupting membrane insertion.

  • Solubility enhancement: For membrane proteins that tend to form inclusion bodies, co-expression with chaperones or the use of solubility-enhancing fusion partners may improve yield of functional protein.

The challenge with membrane proteins like FbpB is that they often form inclusion bodies when overexpressed, as observed with similar fusion proteins that existed primarily as insoluble inclusion bodies . Therefore, optimization of expression conditions or refolding protocols may be necessary to obtain functional protein.

What methods can be used to assess the interaction between FbpB and other components of the iron transport system?

To assess interactions between FbpB and other components of the iron transport system, researchers can employ several complementary approaches:

  • Chemical cross-linking and immunoprecipitation: These techniques have successfully demonstrated interactions between related proteins, such as BfpB and BfpG in E. coli . By using membrane-permeable cross-linking agents followed by co-immunoprecipitation with antibodies against FbpB, researchers can identify interacting partners.

  • Bacterial two-hybrid systems: These systems are particularly useful for studying membrane protein interactions and can detect interactions between FbpB and other components of the transport system in vivo.

  • Surface plasmon resonance (SPR): This technique can measure real-time binding kinetics between purified components of the transport system, providing quantitative data on association and dissociation rates.

  • Co-purification assays: If FbpB forms stable complexes with other components, they may co-purify during affinity chromatography, especially when using mild detergent conditions to maintain native interactions.

  • Functional complementation: By creating genetic constructs with mutations in specific components and testing for restoration of function, researchers can identify which interactions are critical for transport activity.

For example, studies with BfpB revealed that it forms a complex with BfpG, and that BfpG is required for the formation and/or stability of the BfpB multimer but not for its outer-membrane localization . Similar methodological approaches could be applied to study FbpB interactions with FbpA and FbpC in the iron transport system.

How can researchers accurately measure iron transport activity mediated by FbpB?

Accurate measurement of FbpB-mediated iron transport requires methodologies that can distinguish between different steps in the transport process. Based on related research, the following approaches are recommended:

  • Radioactive iron (⁵⁵Fe) uptake assays: These provide direct quantification of iron transport into cells. Comparing uptake rates between wildtype and fbpB mutant strains can isolate the contribution of FbpB to the transport process.

  • Growth complementation assays: Expression of functional FbpB should restore growth of iron transport-deficient strains under iron-limited conditions. This approach was successfully used to demonstrate functionality of the fbpABC operon from N. gonorrhoeae when expressed in siderophore-deficient E. coli strains .

  • Membrane vesicle transport assays: Inside-out membrane vesicles containing FbpB can be prepared to measure ATP-dependent iron transport in a controlled system, allowing for manipulation of conditions to assess specific aspects of transport.

  • Fluorescent iron analogs: These can be used to visualize and quantify transport in real-time using fluorescence microscopy or flow cytometry.

  • Binding assays with transport components: As demonstrated with FepB, binding to the substrate (ferrienterobactin in that case) can be measured using techniques like the membrane localization vehicle approach, where the protein is placed in the outer membrane to facilitate binding measurements .

For FbpB specifically, researchers should consider that it functions as part of a complex that requires ATP hydrolysis by FbpC. Therefore, assays should account for the energetic requirements of transport, and controls should verify that observed activity depends on a functional ATPase component.

What structural features are essential for FbpB function in iron transport?

Based on analysis of related transport systems, several structural features are likely essential for FbpB function:

  • Transmembrane domains: As a permease protein, FbpB is expected to contain multiple transmembrane helices that form a channel through the cytoplasmic membrane. Bioinformatic analysis of similar proteins reveals the presence of transmembrane regions that are critical for function .

  • Coupling helices: These interact with the nucleotide-binding domain (like FbpC) to couple ATP hydrolysis to conformational changes that facilitate transport.

  • Substrate binding sites: Specific amino acid residues within the transmembrane domains likely interact with the substrate during transport. For iron transport systems, these often involve histidine, aspartate, or glutamate residues that can coordinate metal ions.

  • Interaction interfaces: Regions that mediate interactions with the periplasmic binding protein (FbpA) and the nucleotide-binding domain (FbpC) are essential for forming a functional transport complex.

The importance of these structural features can be inferred from studies of similar systems. For example, the BfpB protein in E. coli forms a ring-shaped, high-molecular-weight complex in the outer membrane that is stable in 4% sodium dodecyl sulfate at temperatures of ≤65°C . This suggests that oligomerization and stable complex formation may also be important structural features for transport proteins.

For FbpB specifically, site-directed mutagenesis targeting conserved residues within predicted transmembrane domains or interaction interfaces would be valuable for identifying structurally essential regions.

How do mutations in FbpB affect iron transport efficiency and bacterial growth?

Mutations in FbpB can have significant impacts on iron transport efficiency and bacterial growth, particularly under iron-limited conditions. Based on studies of related systems, several effects might be anticipated:

The consequences of such mutations would be most apparent under iron-limited conditions, where efficient iron acquisition becomes critical for bacterial survival and growth. For instance, in the study of the FbpC component (the nucleotide-binding domain of the transport system), a single amino acid substitution (E164D) resulted in a 10-fold reduction in ATPase activity . Similar dramatic effects might be expected for key mutations in FbpB.

To systematically assess the impact of mutations, researchers could create a library of fbpB variants and screen for growth defects under iron limitation, followed by more detailed characterization of transport rates for promising candidates.

What bioinformatic approaches can predict functional domains in FbpB?

Several bioinformatic approaches can effectively predict functional domains in FbpB and guide experimental studies:

  • Transmembrane topology prediction: Programs such as TMHMM, Phobius, or TOPCONS can identify putative transmembrane helices and their orientation relative to the membrane.

  • Conserved domain analysis: Tools like NCBI's Conserved Domain Database (CDD) or Pfam can identify functional domains shared with other membrane transporters.

  • Multiple sequence alignment: Comparing FbpB sequences across bacterial species can highlight conserved residues likely to be functionally important.

  • Protein-protein interaction prediction: Algorithms such as PSICOV or DCA (Direct Coupling Analysis) can identify co-evolving residues that may form interaction interfaces with FbpA or FbpC.

  • Structural modeling: In the absence of crystal structures, homology modeling based on related transporters with known structures can provide insights into the three-dimensional arrangement of functional domains.

These approaches have been successfully applied to similar proteins. For example, bioinformatic analysis of fusion proteins containing components similar to FbpB revealed the presence of transmembrane regions and potential antigenic epitopes . For FbpB specifically, prediction of secondary structure and identification of conserved motifs can guide the design of targeted mutations to test functional hypotheses.

Bioinformatic ToolApplication for FbpB AnalysisExpected Output
TMHMMPrediction of transmembrane helicesNumber and position of transmembrane segments
CDD/PfamIdentification of conserved domainsFunctional domains shared with known transporters
BLAST/Clustal OmegaMultiple sequence alignmentConserved residues across bacterial species
I-TASSER/SWISS-MODELHomology modelingPredicted 3D structure based on related proteins
PSIPREDSecondary structure predictionα-helices and β-sheets in soluble domains

What are the challenges in purifying functional FbpB protein and how can they be overcome?

Purification of functional FbpB protein presents several challenges typical of membrane proteins, with specific strategies required to overcome them:

  • Solubilization challenges: As a membrane protein, FbpB requires careful selection of detergents for extraction from the membrane while maintaining native structure. A screening approach using different detergents (e.g., DDM, LDAO, or CHAPS) at various concentrations is recommended to identify optimal solubilization conditions.

  • Inclusion body formation: Overexpression often leads to inclusion body formation, as observed with similar fusion proteins . To address this:

    • Lower induction temperatures (16-20°C)

    • Reduced inducer concentration

    • Co-expression with chaperones

    • Addition of solubility-enhancing tags like MBP or SUMO

  • Maintaining functionality: Membrane proteins often lose activity during purification. Researchers should:

    • Include stabilizing ligands during purification

    • Use lipid nanodiscs or amphipols as alternatives to detergents

    • Consider on-column refolding techniques

  • Yield limitations: Membrane proteins typically express at lower levels than soluble proteins. Scale-up strategies include:

    • Use of high cell-density fermentation

    • Optimization of media composition

    • Selection of strong, tunable promoters

  • Protein verification: Confirming the identity and integrity of purified FbpB can be accomplished through:

    • Western blotting with anti-HIS antibodies

    • Mass spectrometry analysis

    • N-terminal sequencing

For functional studies, reconstitution into proteoliposomes may be necessary to assess transport activity. This approach has been successful for similar membrane transport proteins and allows for controlled assessment of transport function in a membrane environment.

How can researchers optimize expression systems for producing high yields of soluble FbpB?

Optimizing expression systems for high yields of soluble FbpB requires a multi-faceted approach:

  • Vector design considerations:

    • Use of vectors with tightly regulated promoters (pET-30a has proven effective for similar proteins)

    • Incorporation of fusion partners that enhance solubility (MBP, SUMO, Trx)

    • Inclusion of cleavable tags for tag removal after purification

    • Codon optimization for E. coli expression

  • Host strain selection:

    • BL21(DE3) is a standard choice but may not be optimal for all membrane proteins

    • C41(DE3) and C43(DE3) are specialized strains developed for membrane protein expression

    • Rosetta strains provide rare codons that may be abundant in the native organism

    • SHuffle strains can facilitate disulfide bond formation if relevant

  • Expression condition optimization:

    • Temperature screening (37°C, 30°C, 25°C, 16°C)

    • IPTG concentration titration (0.01-1.0 mM)

    • Induction time optimization (2-24 hours)

    • Media composition (rich media like TB or minimal media depending on experiment)

  • Co-expression strategies:

    • Chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Other components of the transport system (FbpA, FbpC) to stabilize complex formation

    • Rare tRNA-encoding plasmids for sequences with rare codons

  • Membrane protein-specific approaches:

    • Addition of membrane-stabilizing compounds (glycerol, sucrose)

    • Use of E. coli strains with altered membrane composition

    • Directed evolution to select for highly expressing variants

By systematically testing these variables and monitoring expression levels using methods such as Western blotting, researchers can identify conditions that maximize the yield of soluble, functional FbpB.

What techniques can be used to verify the structural integrity of purified FbpB?

Verifying the structural integrity of purified FbpB is crucial for ensuring that functional studies reflect native protein behavior. Several complementary techniques can be employed:

  • Circular Dichroism (CD) Spectroscopy:

    • Provides information about secondary structure content (α-helices, β-sheets)

    • Can assess thermal stability through melting curves

    • Allows comparison with predicted secondary structure composition

  • Size Exclusion Chromatography (SEC):

    • Evaluates oligomeric state and homogeneity

    • When coupled with multi-angle light scattering (SEC-MALS), provides accurate molecular weight determination

    • Can detect aggregation or degradation

  • Limited Proteolysis:

    • Probes tertiary structure through accessibility of protease cleavage sites

    • Well-folded proteins show resistance to digestion at specific sites

    • Digestion patterns can be compared between wildtype and mutant proteins

  • Thermal Shift Assays:

    • Measures protein stability through unfolding transitions

    • Can detect stabilization by ligands or interaction partners

    • High-throughput method suitable for screening buffer conditions

  • Structural Analysis:

    • Cryo-electron microscopy for larger complexes

    • X-ray crystallography if crystals can be obtained (challenging for membrane proteins)

    • NMR for specific domains or fragments

  • Functional Assays:

    • Binding assays with transport substrates or partner proteins

    • ATPase activity measurements when co-purified with FbpC

    • Reconstitution into liposomes for transport assays

For membrane proteins like FbpB, additional considerations include detergent screening to identify conditions that maintain native structure. Techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide insights into conformational dynamics and ligand-induced structural changes, which are particularly relevant for transport proteins that undergo conformational cycles during function.

How does FbpB contribute to bacterial adaptation to iron-limited environments?

FbpB plays a crucial role in bacterial adaptation to iron-limited environments through several mechanisms:

  • High-affinity iron transport: As part of the FbpABC transport system, FbpB enables bacteria to efficiently import iron even when environmental concentrations are extremely low. In Neisseria species, this system allows acquisition of iron from host iron-binding proteins like transferrin and lactoferrin .

  • Energy-efficient transport: The ABC transporter architecture, including the permease component FbpB, couples ATP hydrolysis to iron transport, providing an energy-efficient mechanism for nutrient acquisition. This is evidenced by the intrinsic ATPase activity of FbpC (0.5 mmol/min/mg), which drives the transport process .

  • Selective permeability: FbpB likely forms a selective channel that allows specific transport of iron while excluding other ions or compounds, maximizing the efficiency of the uptake system.

  • Integration with regulatory networks: Iron transport systems are typically regulated in response to iron availability, with expression increasing under iron-limited conditions. This regulation ensures that energy is not wasted on unnecessary transport when iron is abundant.

For pathogenic bacteria, adaptation to iron limitation is particularly important during infection, as hosts actively sequester iron as a defense mechanism. The FbpABC system represents a sophisticated adaptation to overcome this "nutritional immunity" and acquire essential iron from host proteins. Bacteria lacking functional FbpB would likely show growth defects under iron-limited conditions and potentially reduced virulence in infection models.

What experimental evidence links FbpB function to bacterial virulence in infection models?

While direct evidence linking E. coli FbpB to virulence in infection models is not presented in the search results, research on related iron transport systems provides insights into the critical role these systems play in pathogenesis:

  • Growth in iron-limited environments: Functional iron transport systems are essential for bacterial growth in host environments where iron is sequestered by host proteins. The ability of the fbpABC operon to enable growth of siderophore-deficient E. coli strains in the presence of iron chelators demonstrates its role in iron acquisition under limiting conditions .

  • Host protein interaction: In pathogenic Neisseria, the FbpABC system works in conjunction with surface receptors for host iron-binding proteins like transferrin and lactoferrin, facilitating iron acquisition during infection . This sophisticated mechanism represents a virulence adaptation specific to the human host.

  • Immune evasion: Some bacterial iron transport components, like FbpA and FbpB in Borrelia miyamotoi, have been shown to have immunomodulatory functions, binding human complement C1r and protecting against complement-mediated killing . This dual role in nutrient acquisition and immune evasion highlights the importance of these proteins in virulence.

  • Persistence in chronic infection: Iron acquisition systems are particularly important for bacterial persistence in chronic infections, where sustained growth under iron limitation is required.

For researchers studying E. coli FbpB specifically, experimental approaches to establish virulence connections might include:

  • Creation of fbpB deletion mutants and assessment in relevant infection models

  • Complementation studies to confirm that observed virulence defects are specifically due to loss of FbpB

  • In vivo expression analysis to confirm upregulation during infection

  • Competition assays between wildtype and fbpB mutants in iron-limited environments

How does FbpB interact with host factors during infection?

The interaction between bacterial iron transport systems and host factors represents a critical aspect of the host-pathogen relationship. Based on research with related systems, several potential interactions involving FbpB can be proposed:

  • Indirect interactions with host iron-binding proteins: While FbpB itself (as a membrane permease) likely does not directly contact host proteins, it functions as part of a system that acquires iron from host transferrin and lactoferrin. In Neisseria species, specialized surface receptors initially bind these host proteins, and then the iron is transferred to the periplasmic FbpA before transport via FbpB .

  • Potential immunomodulatory functions: Some bacterial proteins involved in iron transport, such as FbpA and FbpB in Borrelia miyamotoi, have been shown to interact with components of the human complement system. Specifically, these proteins bind human complement C1r and protect against complement-mediated killing . This suggests that iron transport components may have evolved secondary functions related to immune evasion.

  • Involvement in biofilm formation: Iron availability and transport systems can influence bacterial biofilm formation, which represents an important virulence mechanism. FbpB-mediated iron transport might therefore indirectly affect biofilm development and persistence on host surfaces.

  • Potential recognition by host immune receptors: Bacterial membrane proteins can be recognized by pattern recognition receptors of the innate immune system, potentially triggering inflammatory responses.

For E. coli FbpB specifically, research to characterize host interactions could include:

  • Pull-down assays with host proteins to identify direct binding partners

  • Immunological studies to assess recognition by host immune components

  • Biofilm assays comparing wildtype and fbpB mutant strains

  • Transcriptomic analysis of host cells exposed to bacteria with and without functional FbpB

How can FbpB be exploited as a target for novel antimicrobial development?

FbpB represents a promising target for novel antimicrobial development based on several characteristics:

  • Essential function: Iron acquisition is critical for bacterial growth, especially during infection. Disrupting FbpB function could therefore inhibit bacterial growth in the iron-limited host environment.

  • Surface accessibility: As a membrane protein, portions of FbpB may be accessible to antibiotics without requiring cellular penetration, potentially simplifying drug delivery challenges.

  • Conservation and specificity: Iron transport systems show conservation across bacterial pathogens while having limited homology to human proteins, offering the potential for broad-spectrum activity with minimal host toxicity.

  • Structural knowledge: Insights from related permease proteins can guide structure-based drug design targeting critical functional domains of FbpB.

Several approaches for targeting FbpB could be pursued:

  • Small molecule inhibitors: Compounds that bind to FbpB and block the transport channel or disrupt interactions with FbpA or FbpC could inhibit iron uptake. High-throughput screening of chemical libraries against purified FbpB or membrane preparations containing FbpB could identify lead compounds.

  • Peptide inhibitors: Designed peptides that mimic interaction interfaces between FbpB and other transport components could competitively inhibit complex formation. Crystal structures of related proteins, such as the 1.9Å structure of the C1r-binding region of B. miyamotoi FbpA, could guide peptide design .

  • Antibody-based approaches: Antibodies targeting accessible epitopes of FbpB could block function directly or mark bacteria for immune clearance.

  • CRISPR-Cas delivery systems: Novel phage-based delivery systems could target and disrupt the fbpB gene, thereby preventing expression of functional protein.

For researchers pursuing FbpB as an antimicrobial target, careful validation studies would be needed, including demonstration that inhibition of FbpB function leads to growth inhibition under conditions relevant to infection.

What are the current technical limitations in studying FbpB structure and how might they be overcome?

Studying the structure of membrane proteins like FbpB presents several technical challenges, with specific strategies available to overcome these limitations:

  • Crystallization difficulties:

    • Challenge: Membrane proteins are notoriously difficult to crystallize due to their hydrophobic surfaces and conformational flexibility.

    • Solutions:

      • Lipidic cubic phase crystallization, which provides a membrane-like environment

      • Crystallization in the presence of antibody fragments to stabilize specific conformations

      • Focus on stable subdomains rather than the full-length protein

  • Expression and purification yields:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins and are difficult to purify in sufficient quantities for structural studies.

    • Solutions:

      • Optimization of expression systems as detailed in section 4.2

      • Fusion with crystallization chaperones like T4 lysozyme

      • Thermostabilizing mutations to improve protein stability during purification

  • Conformational heterogeneity:

    • Challenge: Transport proteins often exist in multiple conformational states, complicating structural determination.

    • Solutions:

      • Use of conformation-specific nanobodies or antibody fragments

      • Mutations that lock the protein in specific conformational states

      • Cryo-EM approaches that can classify different conformational states

  • Detergent interference:

    • Challenge: Detergents used to solubilize membrane proteins can interfere with crystal contacts or create micelle artifacts in structural studies.

    • Solutions:

      • Screening of multiple detergents and amphipathic polymers

      • Use of detergent-free systems like nanodiscs or amphipols

      • Native mass spectrometry to assess protein-detergent complex composition

  • Alternative structural approaches:

    • Cryo-electron microscopy (cryo-EM): Recent advances have made this technique increasingly powerful for membrane protein structure determination, often requiring less protein and accommodating conformational heterogeneity.

    • Solid-state NMR: Can provide structural information on membrane proteins in a native-like lipid environment.

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides information on protein dynamics and ligand binding without requiring crystallization.

By combining these approaches, researchers can work toward overcoming the technical limitations that have historically hampered structural studies of membrane transporters like FbpB.

How might genetic engineering of FbpB improve iron transport efficiency for biotechnological applications?

Genetic engineering of FbpB offers several promising avenues for enhancing iron transport efficiency with applications in biotechnology:

  • Enhanced substrate specificity:

    • Targeted mutations in the transport channel could modify specificity to transport alternative metal ions or iron-chelate complexes.

    • Domain swapping with related transporters could create chimeric proteins with novel transport properties.

    • Directed evolution approaches could select for variants with improved transport rates or altered substrate preferences.

  • Increased stability and expression:

    • Introduction of thermostabilizing mutations could improve protein stability during expression and purification.

    • Codon optimization for the expression host could enhance translation efficiency.

    • Removal of protease recognition sites might reduce degradation during expression.

  • Modified regulatory control:

    • Engineering of promoter regions to allow constitutive expression or response to alternative signals.

    • Modification of protein regions involved in sensing cellular iron status to alter regulatory responses.

    • Introduction of synthetic regulatory circuits to control expression in response to desired signals.

  • Fusion protein approaches:

    • Creation of fusion proteins that combine FbpB with other functional domains, similar to the fbpB-esxA fusion approach used with Mycobacterium tuberculosis proteins .

    • Development of reporter fusions for monitoring transport activity in real-time.

  • Potential biotechnological applications:

    • Bioremediation: Engineered bacteria with enhanced metal uptake systems could be used for environmental cleanup of metal contaminants.

    • Biosensors: Modified FbpB systems could serve as the basis for whole-cell biosensors detecting specific metals.

    • Metabolic engineering: Enhanced iron uptake could improve production of iron-dependent enzymes or metabolites in industrial strains.

    • Vaccine development: Engineered FbpB proteins could be incorporated into vaccine formulations, as suggested by the bioinformatics analysis of fusion proteins containing FbpB-like components .

When designing genetic modifications, researchers should consider that transport proteins like FbpB function as part of multicomponent systems. Therefore, coordinated engineering of multiple components (FbpA, FbpB, FbpC) may be necessary to achieve significant improvements in transport efficiency.

How conserved is FbpB structure and function across different bacterial pathogens?

Analysis of FbpB and related iron transport permease proteins across bacterial species reveals patterns of conservation and divergence that reflect evolutionary adaptations to different niches:

  • Core structural features:

    • Transmembrane domains show significant conservation, particularly in residues lining the transport channel.

    • ATP-binding cassette (ABC) transporter architecture is maintained across diverse species, reflecting the fundamental importance of this transport mechanism.

    • Interface regions that interact with the nucleotide-binding domain (like FbpC) show higher conservation than periplasmic-facing regions.

  • Species-specific adaptations:

    • Surface-exposed regions often show greater sequence divergence, likely reflecting adaptation to different host environments or immune pressures.

    • Substrate specificity can vary between species, with some systems specialized for free iron transport while others handle iron bound to specific chelators.

    • In Neisseria species, the FbpABC system is adapted to acquire iron from human transferrin and lactoferrin, representing a host-specific adaptation .

  • Taxonomic distribution:

    • FbpB-like permeases are widely distributed across gram-negative bacteria.

    • Functional analogs exist in gram-positive bacteria, though with different architectural arrangements due to the absence of a periplasmic space.

    • The FbpA, FbpB, and FbpC components are typically encoded in a single operon, but genomic organization can vary.

  • Functional conservation:

    • The basic function of iron transport is conserved, but mechanisms may differ.

    • In some species, like Borrelia miyamotoi, FbpB proteins have acquired additional immunomodulatory functions, binding human complement C1r and protecting against complement-mediated killing .

    • The division of functions between separate proteins (as in Borrelia with FbpA and FbpB having distinct roles) versus multifunctional proteins varies across species .

Understanding these patterns of conservation and divergence is valuable for researchers developing broad-spectrum antimicrobials targeting FbpB or using FbpB as a model system for studying membrane transport mechanisms.

What can be learned from studying FbpB homologs in other bacterial species?

Studying FbpB homologs across bacterial species offers valuable insights that can advance understanding of E. coli FbpB and bacterial iron transport more broadly:

  • Functional insights:

    • Identification of conserved residues critical for transport, revealed through comparative sequence analysis.

    • Discovery of novel functions, as seen with Borrelia miyamotoi FbpB, which binds human complement C1r in addition to its role in iron transport .

    • Understanding of how different bacteria have adapted similar transport machinery to diverse environmental niches and host interactions.

  • Structural information:

    • Crystal structures obtained from homologs can serve as templates for modeling E. coli FbpB.

    • The high-resolution X-ray crystallography structures of the C1r-binding regions of B. miyamotoi FbpA and FbpB (at 1.9Å and 2.1Å, respectively) provide valuable structural information that may inform studies of related domains in E. coli proteins .

    • Comparison of structures across species can identify conserved structural motifs that may not be apparent from sequence analysis alone.

  • Evolutionary perspectives:

    • Tracing the evolutionary history of FbpB reveals how iron transport systems have co-evolved with bacterial lifestyles and host interactions.

    • Identification of horizontal gene transfer events that may have contributed to the spread of virulence-associated transport systems.

    • Understanding how duplication and divergence have led to specialized functions, as seen with the partially overlapping but distinct functions of FbpA and FbpB in Borrelia .

  • Methodological advantages:

    • Some homologs may be more amenable to expression, purification, or crystallization, providing experimental systems to study conserved mechanisms.

    • Heterologous expression systems, such as expressing Neisseria fbpABC in E. coli, can provide functional insights into transport mechanisms .

    • Complementation studies across species can reveal functional conservation and specificity.

By integrating information from diverse bacterial species, researchers can develop more comprehensive models of FbpB function and evolution, ultimately informing approaches to target these systems for therapeutic intervention or biotechnological applications.

How do differences in FbpB across bacterial species relate to host specificity and pathogenesis?

The variation in FbpB and related iron transport systems across bacterial species often reflects adaptations to specific host environments and pathogenic strategies:

  • Host iron-binding protein recognition:

    • In Neisseria species, the iron transport system is specifically adapted to acquire iron from human transferrin and lactoferrin, reflecting their strict human host specificity .

    • Variations in FbpB may complement surface receptor specificity, optimizing transport efficiency for particular host-derived iron sources.

    • Bacteria that infect multiple host species may possess more versatile transport systems or multiple specialized systems.

  • Immune evasion adaptations:

    • The acquisition of immunomodulatory functions by iron transport components, as seen with Borrelia miyamotoi FbpA and FbpB binding to human complement C1r, represents a sophisticated adaptation that links nutrient acquisition to immune evasion .

    • Species-specific variations in surface-exposed regions of FbpB may reflect adaptations to evade host immune recognition in different host species.

    • The differential ability of B. miyamotoi FbpA and FbpB to recognize activated C1r versus zymogen states demonstrates fine-tuned adaptation to the host immune environment .

  • Niche-specific adaptations:

    • Variations in FbpB may reflect adaptation to different infection sites within the host, each presenting unique challenges for iron acquisition.

    • Blood-borne pathogens like Borrelia face different iron-acquisition challenges compared to enteric pathogens like E. coli, potentially driving divergent evolution of their iron transport systems.

    • The efficiency and regulation of iron transport systems may correlate with the iron availability in the preferred host niche.

  • Pathogenesis implications:

    • The essential role of iron acquisition in bacterial growth links FbpB function directly to virulence potential.

    • Variations in transport efficiency may influence the ability of different bacterial species to establish infection and cause disease.

    • The dual functions observed in some FbpB homologs (transport and immune evasion) highlight how pathogens can evolve multifunctional virulence factors.

This comparative perspective is valuable for understanding how iron transport systems contribute to host specificity and pathogenic potential across bacterial species, potentially informing strategies for species-specific therapeutic interventions.

What are the most promising unexplored aspects of FbpB research?

Several promising research directions remain unexplored or underdeveloped in the field of FbpB research:

These research directions represent opportunities to significantly advance understanding of bacterial iron transport while potentially yielding applications in medicine, biotechnology, and basic science.

How might emerging technologies enhance our understanding of FbpB structure and function?

Emerging technologies offer exciting opportunities to overcome current limitations in FbpB research and provide unprecedented insights into its structure and function:

  • Advanced structural determination methods:

    • Cryo-electron microscopy (cryo-EM): Recent advances in resolution now enable visualization of membrane proteins without crystallization. Single-particle cryo-EM could capture FbpB in different conformational states during the transport cycle.

    • Microcrystal electron diffraction (MicroED): Allows structure determination from crystals too small for traditional X-ray crystallography, potentially overcoming challenges in growing large membrane protein crystals.

    • Integrative structural biology: Combining multiple data sources (cryo-EM, crosslinking mass spectrometry, computational modeling) to build comprehensive structural models.

  • Dynamic structural approaches:

    • Time-resolved structural methods: Techniques like time-resolved X-ray free-electron laser crystallography can capture transient conformational states during transport.

    • Single-molecule FRET: Enables real-time tracking of protein dynamics in near-native conditions, ideal for studying conformational changes during transport.

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides insights into protein dynamics and ligand-induced conformational changes without requiring crystallization.

  • Advanced computational methods:

    • Molecular dynamics simulations: Increasingly powerful computational resources allow simulation of membrane proteins in explicit membrane environments over biologically relevant timescales.

    • Machine learning approaches: Can predict protein-protein interactions, functional sites, and effects of mutations with improving accuracy.

    • AlphaFold and related AI tools: Dramatically improve protein structure prediction, potentially providing accurate models of FbpB even without experimental structures.

  • High-throughput functional approaches:

    • CRISPR-based screening: Enables systematic functional characterization of FbpB residues through high-throughput mutagenesis and phenotypic screening.

    • Deep mutational scanning: Comprehensive analysis of how thousands of mutations affect FbpB function and stability.

    • Microfluidics-based assays: Allow rapid testing of transport function under precisely controlled conditions.

  • Advanced imaging techniques:

    • Super-resolution microscopy: Visualization of FbpB localization and dynamics in living cells at nanometer resolution.

    • Correlative light and electron microscopy (CLEM): Combines functional information from fluorescence with ultrastructural details.

    • Live-cell imaging with genetically encoded sensors: Real-time monitoring of iron transport in living cells.

By leveraging these technologies, researchers can address fundamental questions about FbpB structure, dynamics, and function that have previously been technically challenging or impossible to approach.

What interdisciplinary approaches could yield new insights into FbpB biology?

Interdisciplinary approaches combining expertise and methodologies from multiple fields offer particularly promising avenues for advancing FbpB research:

  • Biophysics-microbiology integration:

    • Application of single-molecule biophysical techniques to study FbpB dynamics in conjunction with microbiological phenotyping.

    • Correlation of transport kinetics measured in reconstituted systems with bacterial growth under varying iron conditions.

    • Development of biophysical tools specifically designed for membrane transport proteins in bacterial systems.

  • Immunology-microbiology collaboration:

    • Investigation of how FbpB-mediated iron acquisition influences host immune responses during infection.

    • Exploration of potential immunomodulatory functions of FbpB, similar to those observed with Borrelia FbpB .

    • Study of how iron competition between host and pathogen shapes immune outcomes.

  • Systems biology-structural biology interface:

    • Integration of structural information with network analyses to understand how FbpB functions within the broader context of cellular iron homeostasis.

    • Development of computational models that incorporate structural dynamics into predictions of system-level behaviors.

    • Multi-scale modeling from atomic interactions to cellular phenotypes.

  • Synthetic biology approaches:

    • Engineering of FbpB variants with novel functions or improved properties based on structural and functional insights.

    • Creation of synthetic cellular circuits that integrate iron sensing and transport for programmed bacterial behaviors.

    • Development of minimal systems to study fundamental aspects of transport mechanisms.

  • Evolutionary biology perspectives:

    • Comparative genomics and phylogenetics to trace the evolution of FbpB across bacterial lineages.

    • Experimental evolution to observe adaptation of iron transport systems under controlled selective pressures.

    • Ancestral sequence reconstruction to study the functional properties of evolutionary predecessors of modern FbpB.

  • Chemical biology tools:

    • Development of small molecule probes that interact specifically with FbpB to study its function.

    • Photocrosslinking approaches to capture transient protein-protein interactions during transport.

    • Design of activity-based probes to monitor FbpB function in complex biological samples.

By bringing together diverse expertise and methodologies, these interdisciplinary approaches can tackle complex questions about FbpB biology that cannot be addressed within the confines of traditional disciplinary boundaries.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.