Recombinant Escherichia coli Putative inner membrane protein yafU (yafU)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this need in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it accordingly.
Synonyms
yafU; b0218; JW0207; Putative inner membrane protein YafU
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yafU
Target Protein Sequence
MSSERDLVNFLGDFSMDVAKAVIAGGVATAIGSLASFACVSFGFPVILVGGAILLTGIVC TVVLNEIDAQCHLSEKLKYAIRDGLKRQQELDKWKRENMTPFMYVLNTPPVI
Uniprot No.

Target Background

Database Links

KEGG: ecj:JW0207

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant yafU protein?

The most effective expression system for producing recombinant yafU protein is E. coli itself, with the protein being expressed with an N-terminal His tag for purification purposes . This homologous expression system is advantageous because:

  • It ensures proper membrane insertion of the protein

  • It maintains the native folding environment

  • It allows for higher yields of functional protein

The expression typically results in the protein being incorporated into the bacterial inner membrane, from which it can be extracted using appropriate detergents. For optimal results, expression conditions should be carefully controlled with induction at mid-log phase (OD600 of 0.6-0.8) and growth at temperatures between 16-30°C to prevent inclusion body formation .

What are the recommended storage and reconstitution protocols for lyophilized yafU protein?

For optimal stability and activity of lyophilized yafU protein, the following storage and reconstitution protocols are recommended:

Storage protocol:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended default: 50%)

  • Aliquot for long-term storage at -20°C/-80°C

This protocol maximizes protein stability while maintaining functional integrity for experimental applications.

How does the membrane topology of yafU compare with other E. coli inner membrane proteins, and what methodologies are best for topology determination?

The yafU protein likely shares topological features with other E. coli inner membrane proteins such as YfgM and PpiD, which have N-terminal transmembrane segments and C-terminal domains exposed to specific cellular compartments . Based on comparative analysis, yafU may adopt an N-IN-C-OUT topology (N-terminus in cytoplasm, C-terminus in periplasm) or potentially multiple transmembrane segments.

Recommended methodologies for topology determination:

  • Cysteine accessibility scanning: Systematically introduce cysteine residues throughout the protein sequence and assess their accessibility to membrane-impermeable sulfhydryl reagents

  • GFP-fusion analysis: Create fusion proteins with GFP at different positions and determine fluorescence localization in spheroplasts versus intact cells

  • Protease protection assays: Expose membrane vesicles with different orientations to proteases and analyze the protected fragments

  • Computational prediction combined with experimental validation: Use algorithms like TMHMM and Phobius alongside experimental approaches for higher confidence results

These complementary approaches can generate a comprehensive topological model of yafU, which is essential for understanding its functional mechanisms in the membrane environment.

What potential functional roles might yafU play in E. coli based on its sequence homology and genomic context?

While the specific function of yafU remains to be fully characterized, several potential roles can be inferred from sequence analysis and comparison with other membrane proteins:

  • Membrane transport: The hydrophobic regions and predicted transmembrane segments suggest yafU may function as a transporter or channel for specific substrates across the inner membrane

  • Protein translocation assistance: By analogy with the YfgM-PpiD heterodimer, which interacts with the SecG translocon subunit and facilitates protein translocation across the inner membrane, yafU may play a role in protein secretion or membrane protein integration

  • Stress response: Many inner membrane proteins in E. coli are involved in stress responses. Given that proteins like YfgM play roles in envelope stress responses, yafU might have similar functions

  • Metabolic enzyme activity: Some membrane proteins participate in metabolic pathways. The presence of homologs in different bacterial species suggests a conserved function that could be metabolically relevant

The functional characterization would benefit from studies examining protein-protein interactions, phenotypic analysis of deletion mutants, and transcriptional profiling under various stress conditions.

What are the optimal purification strategies for maintaining the structural integrity of recombinant yafU protein?

Purifying membrane proteins while maintaining their structural integrity presents significant challenges. For recombinant His-tagged yafU protein, the following optimized purification strategy is recommended:

  • Membrane fraction isolation:

    • Harvest cells expressing yafU-His by centrifugation

    • Resuspend in buffer containing protease inhibitors

    • Disrupt cells by sonication or French press

    • Remove unbroken cells and debris by low-speed centrifugation

    • Isolate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

  • Detergent screening and solubilization:

    • Test multiple detergents for optimal solubilization (DDM, LDAO, or C12E8)

    • Solubilize membranes in buffer containing selected detergent at 1-2% (w/v)

    • Incubate with gentle rotation at 4°C for 1-2 hours

    • Remove insoluble material by ultracentrifugation

  • Affinity chromatography:

    • Apply solubilized fraction to Ni-NTA or TALON resin

    • Wash with buffer containing reduced detergent concentration (0.1-0.05%)

    • Elute with imidazole gradient (50-300 mM)

  • Size-exclusion chromatography:

    • Apply concentrated protein to SEC column equilibrated with buffer containing detergent at CMC

    • Collect fractions containing monodisperse protein

  • Quality assessment:

    • Analyze purity by SDS-PAGE (>90% purity expected)

    • Verify folding by circular dichroism

    • Assess aggregation state by dynamic light scattering

This protocol maximizes the chances of obtaining homogeneous, properly folded yafU protein suitable for structural and functional studies.

How might the function of yafU relate to other membrane proteins like YafP, and what experimental approaches would best test these relationships?

While direct evidence linking yafU and YafP functions is limited, their genetic proximity in some E. coli strains suggests potential functional relationships. YafP has been characterized as modulating DNA damaging properties of nitroaromatic compounds and is likely an acetyltransferase that participates in metabolic transformation of genotoxic compounds .

Potential functional relationships:

  • Metabolic pathway coupling: yafU might function as a transporter for substrates that YafP subsequently modifies

  • Stress response coordination: Both proteins might be induced under similar stress conditions

  • Protein complex formation: They might interact directly or as part of a larger functional complex

Recommended experimental approaches:

  • Co-expression and co-immunoprecipitation studies:

    • Express tagged versions of both proteins

    • Perform pull-down assays to detect physical interactions

    • Use crosslinking approaches to capture transient interactions

  • Comparative phenotypic analysis:

    • Generate single and double deletion mutants (ΔyafU, ΔyafP, ΔyafUΔyafP)

    • Compare growth phenotypes under various stress conditions

    • Assess sensitivity to DNA-damaging agents, similar to studies performed with YafP

  • Transcriptional analysis:

    • Perform RNA-seq or qPCR under conditions known to induce SOS response

    • Compare expression patterns of yafU and yafP genes

  • Biochemical function analysis:

    • Test if yafU affects the transport of compounds that YafP metabolizes

    • Examine if YafP acetylation activity is influenced by yafU expression

These approaches would provide insights into potential functional relationships between these membrane proteins.

What techniques can be applied to study potential protein-protein interactions involving yafU in the membrane environment?

Studying protein-protein interactions in membrane environments presents unique challenges. The following techniques are particularly valuable for investigating yafU interactions:

  • In vivo photocrosslinking with unnatural amino acids:

    • Incorporate p-benzoyl-L-phenylalanine (pBPA) at specific positions in yafU

    • UV-irradiate cells to induce crosslinking with nearby proteins

    • Identify crosslinked partners by immunoprecipitation and mass spectrometry

    • This approach has been successfully applied to study YfgM-PpiD interactions with SecG

  • Bacterial two-hybrid systems adapted for membrane proteins:

    • Use split-ubiquitin or BACTH (Bacterial Adenylate Cyclase Two-Hybrid) systems

    • Create fusion constructs between yafU and the reporter protein fragments

    • Screen for interactions by measuring reporter activation

  • Förster Resonance Energy Transfer (FRET):

    • Generate fluorescent protein fusions (e.g., CFP and YFP) with yafU and potential partners

    • Measure energy transfer as an indication of proximity in the membrane

    • Calculate FRET efficiency to estimate interaction strength

  • Co-evolution analysis combined with experimental validation:

    • Use computational approaches to identify proteins that co-evolve with yafU

    • Validate predicted interactions experimentally

    • This approach has identified functional relationships between membrane proteins

  • Cryo-electron microscopy of membrane fractions:

    • Isolate membrane fractions enriched in tagged yafU

    • Apply cryo-EM to visualize protein complexes in native-like lipid environments

    • Identify binding partners through image classification and 3D reconstruction

A combination of these approaches would provide complementary evidence for the interaction network of yafU in the membrane environment.

How does the structural stability of yafU compare in different membrane mimetic systems, and what implications does this have for functional studies?

The structural stability of membrane proteins like yafU can vary significantly across different membrane mimetic systems, with important implications for functional studies:

Comparative stability in different systems:

Membrane Mimetic SystemAdvantagesLimitationsRecommended Applications
Detergent micelles (DDM, LDAO)Simple preparation, good for initial studiesMay not maintain native structure long-termInitial purification, preliminary characterization
Lipid nanodiscsBilayer environment, defined sizeComplex assembly, limited lipid compositionStructural studies, controlled lipid environment experiments
ProteoliposomesAuthentic bilayer, supports functional assaysHeterogeneous orientation, large sizeTransport assays, membrane protein reconstitution
AmphipolsHigh stability, low detergentNot suitable for all functional studiesLong-term storage, structural studies
Native nanodiscs (SMALPs)Extracts protein with native lipidsLimited compatibility with functional assaysStudying native lipid interactions

Implications for functional studies:

  • Transport assays should preferentially use proteoliposomes where yafU can be incorporated with defined orientation

  • Binding studies may be performed in nanodiscs or detergent micelles, but results should be validated across multiple systems

  • Structural studies benefit from systems that provide long-term stability (amphipols or nanodiscs)

  • Interaction studies with other membrane proteins should consider compatible systems that accommodate multiple membrane proteins

The choice of membrane mimetic should be guided by the specific research question and validated by confirming protein folding using techniques like circular dichroism or fluorescence spectroscopy.

What are the most reliable approaches for assessing the functional activity of recombinant yafU protein?

In the absence of a definitively known function for yafU, multiple complementary approaches should be employed to assess its potential activities:

  • Transport assays in proteoliposomes:

    • Reconstitute purified yafU into liposomes

    • Test transport of various radiolabeled or fluorescent substrates

    • Monitor changes in internal vesicle composition over time

    • Compare transport rates with control liposomes lacking yafU

  • Binding assays with potential substrates:

    • Use techniques such as microscale thermophoresis (MST) or isothermal titration calorimetry (ITC)

    • Screen a library of potential substrates for binding interactions

    • Determine binding constants for positive hits

  • Phenotypic analysis of deletion mutants:

    • Generate ΔyafU strains in E. coli

    • Assess growth under various stress conditions

    • Compare membrane integrity using fluorescent dyes

    • Evaluate resistance to antibiotics that target membrane functions

  • Protein interaction mapping:

    • Identify interaction partners using pull-down assays

    • Validate interactions using techniques described in section 3.5

    • Infer function from known roles of interaction partners

  • Comparative analysis with other bacterial species:

    • Identify homologs in other bacteria with known functions

    • Test if yafU can complement deletion mutants of these homologs

    • Use structural modeling to identify conserved functional motifs

These methods collectively provide a systematic approach to uncovering the functional role of yafU, even in the absence of prior functional information.

How can researchers effectively design mutation studies to probe structure-function relationships in yafU?

Designing effective mutation studies for membrane proteins like yafU requires strategic targeting of residues based on computational analysis and evolutionary conservation:

Systematic mutation design approach:

  • Sequence alignment and conservation analysis:

    • Align yafU sequences from multiple bacterial species

    • Identify highly conserved residues that likely play crucial functional roles

    • Generate conservation scores for each position in the sequence

  • Computational structure prediction:

    • Use AlphaFold2 or similar tools to predict yafU structure

    • Identify potential functional motifs or domains

    • Map conserved residues onto the structural model

  • Targeted mutation categories:

    a. Transmembrane domain mutations:

    • Replace conserved polar residues in transmembrane regions

    • Substitute glycine residues that might provide conformational flexibility

    • Modify residues in predicted substrate-binding pockets

    b. Loop region mutations:

    • Target charged residues in loop regions

    • Modify potential interface residues for protein-protein interactions

    • Alter residues with potential post-translational modifications

    c. Functional motif mutations:

    • Identify sequence motifs shared with proteins of known function

    • Mutate key residues within these motifs

  • Mutation validation:

    • Express mutant proteins and verify proper membrane integration

    • Assess structural integrity using spectroscopic methods

    • Compare stability and folding with wild-type protein

  • Functional impact assessment:

    • Test each mutant in the functional assays described in section 4.1

    • Quantify the degree of functional impairment

    • Correlate structural changes with functional effects

This systematic approach maximizes the information gained from mutation studies while minimizing the number of mutations required.

What are the current challenges and solutions in crystallizing membrane proteins like yafU for structural determination?

Membrane protein crystallization remains challenging despite significant advances. For proteins like yafU, specific challenges and their potential solutions include:

Current challenges:

  • Protein instability in detergents: Membrane proteins often denature during purification and crystallization

  • Conformational heterogeneity: Proteins may adopt multiple conformations, hindering crystal formation

  • Limited polar surface area: Membrane regions provide few contacts for crystal lattice formation

  • Detergent micelle interference: Micelles can obstruct protein-protein contacts needed for crystallization

  • Low expression yields: Obtaining sufficient quantities of pure protein is difficult

Innovative solutions:

  • Fusion partner approaches:

    • Engineer fusion constructs with crystallization chaperones (e.g., T4 lysozyme, BRIL)

    • Insert these partners into loop regions to increase polar surface area

    • This approach has successfully yielded structures of challenging membrane proteins

  • Lipidic cubic phase (LCP) crystallization:

    • Reconstitute yafU into lipidic mesophases that mimic the native membrane

    • This method has revolutionized GPCR crystallography and may be applicable to yafU

    • LCP provides a more native-like environment that can stabilize functional conformations

  • Antibody fragment co-crystallization:

    • Generate Fab or nanobody fragments that bind specifically to yafU

    • Co-crystallize these complexes to increase polar surface area

    • This approach can also stabilize specific conformations

  • Detergent screening and optimization:

    • Systematically test novel detergents and detergent mixtures

    • Use fluorescence-based thermal stability assays to identify optimal conditions

    • Consider facial amphiphiles and other novel solubilizing agents

  • Alternative structural methods when crystallization fails:

    • Cryo-electron microscopy for single-particle analysis

    • Solid-state NMR for structural constraints in a native-like environment

    • Integrative structural modeling combining multiple experimental data sources

These approaches significantly increase the chances of obtaining structural information for challenging membrane proteins like yafU.

How can high-throughput omics data be integrated to understand the physiological context of yafU function in E. coli?

Understanding the physiological role of yafU requires integration of multiple omics datasets to place it in the broader context of cellular function:

Multi-omics integration approach:

  • Transcriptomic analysis:

    • Identify conditions where yafU expression is significantly altered

    • Perform RNA-seq comparing wild-type and ΔyafU strains under various conditions

    • Identify co-expressed genes that may function in the same pathway

  • Proteomic profiling:

    • Quantify changes in membrane proteome composition in ΔyafU strains

    • Identify potential compensatory changes in other membrane proteins

    • Use SILAC or TMT labeling for accurate quantification

  • Metabolomic analysis:

    • Compare metabolite profiles between wild-type and ΔyafU strains

    • Focus on membrane-associated metabolites and potential substrates

    • Identify metabolic pathways affected by yafU deletion

  • Interactomic data:

    • Perform systematic protein-protein interaction screens

    • Use methods described in section 3.5 to identify interaction partners

    • Map yafU to known protein complexes and pathways

  • Integration and network analysis:

    • Construct functional networks incorporating all omics data

    • Identify network modules where yafU plays a central role

    • Use machine learning approaches to predict functional associations

This integrated approach can reveal the physiological context of yafU function even when direct biochemical assays are challenging, providing a systems-level understanding of its role in cellular physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.