Recombinant Escherichia coli Putative membrane protein igaA homolog (yrfF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yrfF; b3398; JW3361; Putative membrane protein IgaA homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-711
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yrfF
Target Protein Sequence
MSTIVIFLAALLACSLLAGWLIKVRSRRRQLPWTNAFADAQTRKLTPEERSAVENYLESL TQVLQVPGPTGASAAPISLALNAESNNVMMLTHAITRYGISTDDPNKWRYYLDSVEVHLP PFWEQYINDENTVELIHTDSLPLVISLNGHTLQEYMQETRSYALQPVPSTQASIRGEESE QIELLNIRKETHEEYALSRPRGLREALLIVASFLMFFFCLITPDVFVPWLAGGALLLLGA GLWGLFAPPAKSSLREIHCLRGTPRRWGLFGENDQEQINNISLGIIDLVYPAHWQPYIAQ DLGQQTDIDIYLDRHVVRQGRYLSLHDEVKNFPLQHWLRSTIIAAGSLLVLFMLLFWIPL DMPLKFTLSWMKGAQTIEATSVKQLADAGVRVGDTLRISGTGMCNIRTSGTWSAKTNSPF LPFDCSQIIWNDARSLPLPESELVNKATALTEAVNRQLHPKPEDESRVSASLRSAIQKSG MVLLDDFGDIVLKTADLCSAKDDCVRLKNALVNLGNSKDWDALVKRANAGKLDGVNVLLR PVSAESLDNLVATSTAPFITHETARAAQSLNSPAPGGFLIVSDEGSDFVDQPWPSASLYD YPPQEQWNAFQKLAQMLMHTPFNAEGIVTKIFTDANGTQHIGLHPIPDRSGLWRYLSTTL LLLTMLGSAIYNGVQAWRRYQRHRTRMMEIQAYYESCLNPQLITPSESLIE
Uniprot No.

Target Background

Database Links
Protein Families
IgaA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the igaA/yrfF protein and what is its primary function in Escherichia coli?

The igaA protein (known as yrfF in E. coli) is an essential inner membrane protein that functions as a negative regulator of the Rcs phosphorelay system. This regulatory system is used by bacteria of the Enterobacterales order to withstand envelope damage . Under non-stress conditions, igaA/yrfF represses the Rcs system, preventing unnecessary activation which could be detrimental for bacterial viability . The protein was originally identified in Salmonella and named for its role in intracellular growth attenuation, while the E. coli homolog is referred to as yrfF or igaA .

Why is igaA/yrfF considered essential in E. coli?

The igaA/yrfF genes are essential for growth in Salmonella and E. coli bacteria . This essentiality stems from their critical function as repressors of the Rcs phosphorelay system. Without igaA/yrfF, uncontrolled activation of the Rcs system occurs, which has been shown to be detrimental to cell viability . Deletion of igaA is only possible in cells that have mutations in rcsC, rcsD, or rcsB, which are components of the Rcs system . This demonstrates that the essentiality of igaA is directly linked to its role in regulating the Rcs phosphorelay cascade.

What is the structural organization of the igaA/yrfF protein?

The igaA/yrfF protein exhibits a complex structural organization:

  • Five transmembrane domains (TM) that anchor the protein in the bacterial inner membrane

  • Three defined cytoplasmic regions (cyt1, cyt2, cyt3)

  • A large periplasmic region

Recent structural analyses have revealed the presence of three β-rich architectures forming partially-closed small β-barrel (SBB) domains, which are related to OB (oligonucleotide/oligosaccharide binding motif) fold domains . These domains are designated as:

  • SBB-1: Located entirely in the first cytoplasmic region (cyt1)

  • SBB-2: A "hybrid" domain built by residues of region cyt1 and most of region cyt2

  • SBB-3: Located in the periplasmic region

Each SBB domain is formed by two β-sheets where the first β-strand is connected to an α-helix and the second β-strand is curved, being shared by both β-sheets .

How do mutations in igaA/yrfF affect bacterial phenotype and Rcs system regulation?

Mutations in igaA/yrfF can lead to significant phenotypic changes due to dysregulation of the Rcs system. In Salmonella, partial-function mutations in igaA result in a highly mucoid phenotype due to increased activation of the Rcs system . This hypercapsule phenotype is predicted to confer selective advantages in certain environments, such as providing protection against phagocytic cells .

Specific mutations that have been characterized include:

  • R188H: One of the first identified mutations affecting igaA function, disrupting the E194-R188-D309 interaction in the SBB-2 domain

  • T191P and G262R: Mutations mapping in cyt1 and cyt2 regions that have profound phenotypic effects regarding the loss of repression over the Rcs system and attenuation of virulence

Importantly, while the hypercapsule phenotype suggests that igaA/yrfF may negatively regulate virulence, studies with S. enterica bearing nonlethal mutations in igaA indicate that it is actually required for virulence in infection models .

What is the significance of the "hybrid" SBB-2 domain in igaA/yrfF function?

The "hybrid" SBB-2 domain has emerged as a critical structural element for igaA/yrfF function. This domain is formed by:

  • Most of cytoplasmic region cyt2

  • A β-strand (β7) supplied by the C-terminal residues of cyt1 (sequence 183-ELLNIRQ-189 in IgaA of S. Typhimurium) creating a clear cyt1-cyt2 interface

  • Defined residues of the cyt3 region like R686

Key interactions that stabilize this hybrid domain include:

  • E180-R265: Connecting the SBB-1/SBB-2 connector to a SBB-2 residue

  • E194-R188-D309: Facilitating proximity between strand β7 of region cyt1 and SBB-2 residues in region cyt2

  • H293-E328-R686: Involving two residues of region cyt2 and a residue of region cyt3

The importance of this domain is highlighted by functional studies where heterologous igaA proteins with variations in this domain failed to complement a Salmonella igaA deletion . This suggests that the hybrid nature of the SBB-2 domain is essential for proper signal transduction and Rcs system repression.

How has igaA/yrfF evolved across different bacterial families within Enterobacterales?

Phylogenetic analyses reveal significant insights into igaA/yrfF evolution across the Enterobacterales order:

  • Co-evolution with Rcs components: igaA/yrfF shows marked phylogenetic overlap with RcsC and RcsD, but not with RcsF, RcsB, or unrelated proteins like DnaK . This indicates that igaA/yrfF likely integrated into the Rcs regulatory network primarily through interactions with RcsC/RcsD.

  • Differential conservation: Sequence identity between Salmonella igaA and homologs varies considerably: Shigella (84.1%), Dickeya (49.3%), Yersinia (52.8%), Photorhabdus (39.3%), and Sodalis (47.7%) .

  • Variable essentiality: While igaA/yrfF is essential in Salmonella and E. coli, homologs like umoB in Proteus mirabilis and gumB in Serratia marcescens are not required for survival . This suggests adaptation to different ecological niches.

  • Loss in obligate endosymbionts: Obligate endosymbionts like Buchnera aphidicola and Wigglesworthia glossinidia lack igaA/yrfF and the entire Rcs system , indicating this regulatory system may become dispensable in stable intracellular environments.

Functional complementation studies demonstrate that igaA from Shigella flexneri and Dickeya dadantii can replace Salmonella igaA, but versions from Yersinia enterocolitica, Photorhabdus luminescens, and Sodalis glossinidius cannot , reflecting structural divergence related to lifestyle adaptation.

What approaches can be used to express and study recombinant igaA/yrfF protein?

Expression Systems and Vectors:

  • Arabinose-inducible expression vectors (such as pBAD24) have been successfully used for controlled expression of igaA/yrfF variants

  • Addition of epitope tags (e.g., Myc-tag) at the C-terminus enables protein detection without compromising function

  • Expression should be carefully controlled, as overexpression can lead to toxicity due to altered Rcs system regulation

Purification Strategies:

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using appropriate detergents for membrane proteins

  • Affinity chromatography utilizing epitope tags for purification

  • Size exclusion chromatography for final polishing and oligomeric state determination

Detection Methods:

  • Immunoassays with anti-tag antibodies (e.g., anti-Myc) at 1:1,000 dilution and secondary antibodies at 1:2,000 dilution

  • Sample loading of approximately 5×10^7 bacteria equivalent per gel well is recommended for optimal detection

How can functional complementation assays be designed to test igaA/yrfF variants?

Functional complementation assays leverage the essentiality of igaA/yrfF in certain bacteria to test variant functionality:

Protocol Overview:

  • Clone the igaA/yrfF variant of interest into an inducible expression vector

  • Transform the construct into a strain with a conditional igaA/yrfF mutation or a strain that allows phage transduction of a null allele

  • Induce expression of the cloned variant

  • Assess viability under conditions where the endogenous igaA/yrfF is inactivated

Example Method from Literature:

  • Transform Salmonella strain with plasmid expressing igaA variant under arabinose control

  • Use P22 phage to transduce a null ΔigaA2::KXX allele

  • Plate on media containing kanamycin (to select for the null allele) and arabinose (to induce variant expression)

  • Appearance of transductants indicates functional complementation

Phenotypic Assessment:

  • Monitor colony morphology (mucoidy indicates Rcs overactivation)

  • Assess growth rates under various conditions

  • Measure expression of Rcs-regulated genes using reporter constructs (e.g., P-rprA-mCherry)

What structural analysis techniques are most appropriate for studying igaA/yrfF?

Computational Structure Prediction:

  • AlphaFold and ColabFold have successfully predicted igaA/yrfF structures, enabling identification of key domains and interaction sites

  • Structural superposition can be performed with programs like Superpose and Gesamt in the CCP4 Suite

  • Multiple sequence alignment using tools like PRALINE helps identify conserved regions

Experimental Structure Determination:

  • X-ray crystallography of soluble domains or the full-length protein stabilized with detergents

  • Cryo-electron microscopy for membrane-embedded analysis

  • Nuclear magnetic resonance (NMR) for isolated domains, as demonstrated for the OB-fold domain of E. coli YrfF (PDB: 4UZM)

Interaction Mapping:

  • Site-directed mutagenesis targeting predicted interaction sites

  • Crosslinking studies to capture transient interactions with Rcs components

  • Bacterial two-hybrid or split-GFP assays to monitor protein-protein interactions

Validation Methods:

  • Root-mean-square deviation (RMSD) analysis for comparing predicted structures

  • Structural comparisons with the DALI server to identify similar domains

  • Visualization using tools like UCSF Chimera for structural representation and analysis

How do we reconcile the variable essentiality of igaA/yrfF across different bacteria?

The varying essentiality of igaA/yrfF across bacterial species presents an intriguing research challenge. Several hypotheses can explain this phenomenon:

Differential Rcs System Regulation:

  • In species where igaA/yrfF is essential (E. coli, Salmonella), the Rcs system may be more easily activated or have more critical downstream effects

  • In species where it's non-essential (Proteus, Serratia), there may be redundant regulatory mechanisms or less detrimental consequences of Rcs activation

Methodological Approach to Investigate:

  • Compare the entire Rcs regulon across species using transcriptomics

  • Measure basal and induced Rcs activity in various species with and without igaA/yrfF

  • Introduce heterologous Rcs components to determine if essentiality is transferable

  • Create chimeric igaA/yrfF proteins to map domains responsible for essentiality

Interpretation Framework:

SpeciesigaA/yrfF EssentialityPossible ExplanationInvestigation Method
E. coliEssentialStrong Rcs activation is lethalSuppressors in Rcs components
SalmonellaEssentialStrong Rcs activation is lethalSuppressors in Rcs components
Proteus (umoB)Non-essentialModerate Rcs activation or alternative regulationComparative transcriptomics
Serratia (gumB)Non-essentialModerate Rcs activation or alternative regulationRegulatory network mapping

What explains the differential ability of heterologous igaA proteins to complement in Salmonella?

The observation that igaA from Shigella and Dickeya can complement Salmonella igaA function, while those from Yersinia, Photorhabdus, and Sodalis cannot, reveals important insights about structural-functional relationships .

Key Structural Differences:

  • SBB domain variations: All variants maintain the three SBB domains, but with sequence and structural variations

  • Critical interaction sites: Non-complementing variants lack key interaction sites including H192-P249, R255-D313, and D287-R314

  • α6 helix variations: This helix is almost absent in Yersinia and Sodalis variants and shortened in Photorhabdus

Methodological Approaches to Investigate:

  • Create chimeric proteins swapping domains between complementing and non-complementing variants

  • Perform targeted mutagenesis of divergent residues

  • Use crosslinking experiments to compare interaction profiles with Rcs components

  • Employ in vivo proximity labeling to identify differential interaction partners

Evolutionary Interpretation:
The differential complementation likely reflects adaptation to specific environmental niches and co-evolution with specific Rcs system variants. This provides an excellent opportunity to study how protein-protein interaction networks evolve in response to ecological pressures.

How do we interpret contradictory data regarding the primary site of action for igaA/yrfF?

Research on igaA/yrfF has revealed seemingly contradictory findings regarding its primary site of action:

Periplasmic Model:

  • An interaction between the outer membrane protein RcsF and the periplasmic region of igaA/yrfF was proposed to relieve repression over RcsC/RcsD

  • Interactions between OmpA and RcsF have been reported to modulate the RcsF-igaA interaction

Cytoplasmic Model:

  • Structural analyses reveal more variable sequences and structures in the cytoplasmic regions compared to the periplasmic region

  • The hybrid SBB-2 domain formed by cytoplasmic regions appears critical for function

  • A recombinant igaA in which the periplasmic domain was replaced with the equivalent region of MalF retained its ability to repress the Rcs system

Methodological Resolution Approach:

  • Create domain-specific deletions to map functional regions

  • Employ domain-swapping between igaA variants with different complementation abilities

  • Use site-directed mutagenesis targeting specific interaction sites

  • Develop interactome maps using proximity labeling in different cellular compartments

Integrative Model:
Both periplasmic and cytoplasmic domains likely contribute to igaA/yrfF function, with the periplasmic domain serving as a sensor for envelope stress while the cytoplasmic regions, particularly the hybrid SBB-2 domain, transmit this signal to modulate Rcs system activity. This dual role explains why mutations in either region can affect function.

How has igaA co-evolved with Rcs system components across Enterobacterales?

Phylogenetic analyses provide compelling evidence for co-evolution of igaA/yrfF with specific Rcs components:

Co-evolutionary Patterns:

  • Marked phylogenetic overlap between igaA/yrfF, RcsC, and RcsD phylogenetic trees

  • Less overlap with RcsF, RcsB, or unrelated proteins like DnaK

  • This suggests igaA/yrfF integrated into the Rcs regulatory network primarily by interacting with RcsC/RcsD

Methodological Approaches for Study:

  • Construct comprehensive phylogenetic trees using maximum likelihood methods (e.g., RAxML algorithm with LG evolutionary model)

  • Compare trees using tanglegram analyses to visualize co-evolutionary relationships

  • Calculate correlation coefficients between branch lengths of different protein trees

  • Use mirror tree analyses to identify co-evolving residues between proteins

Evolutionary Insights:
The co-evolution with inner membrane components RcsC/RcsD rather than the outer membrane component RcsF suggests that the primary evolutionary pressure on igaA/yrfF has been to maintain appropriate regulation of the phosphorelay cascade rather than the initial stress sensing.

What does the presence or absence of igaA/yrfF in different bacterial lifestyles tell us about its function?

The distribution of igaA/yrfF across bacteria with different lifestyles provides significant insights:

Pattern of Conservation:

  • Present in most free-living and facultative intracellular Enterobacterales

  • Absent in obligate endosymbionts like Buchnera aphidicola and Wigglesworthia glossinidia

  • Retained but potentially diverged in facultative symbionts like Sodalis glossinidius and Photorhabdus luminescens

Functional Interpretation:
The absence of igaA/yrfF and the entire Rcs system in obligate endosymbionts suggests this regulatory system becomes dispensable in stable intracellular environments. This makes evolutionary sense as:

Methodological Framework for Investigation:

  • Comparative genomics across a range of lifestyle transitions

  • Reconstruction of ancestral gene content

  • Experimental introduction of igaA/yrfF into simplified genomes

  • Analysis of selection pressures using dN/dS ratios

What structural features of igaA/yrfF vary in correlation with bacterial ecological niches?

Analysis of igaA/yrfF across diverse bacteria reveals adaptations potentially related to ecological niches:

Key Variable Structural Features:

  • The loop between α3 and β2 in the SBB-1 domain: longer in Yersinia, shorter in Photorhabdus

  • The α6 helix in cyt1: almost absent in Yersinia and Sodalis, shortened in Photorhabdus

  • The loop between β14-β15 in SBB-3 (periplasmic region)

  • The C-terminal end in cyt3: displays high sequence variability

Niche Correlation Analysis:

Bacterial GroupRepresentative EcologyNotable igaA/yrfF Adaptations
EnterobacteriaceaeDiverse, including intestinalHighly conserved SBB domains
YersiniaSoil, water, animal hostsModified α6 helix, longer α3-β2 loop
PhotorhabdusNematode symbiontShortened α6 helix, shorter α3-β2 loop
SodalisInsect symbiontModified α6 helix, variable C-terminus

Methodological Investigation Approach:

  • Correlation analyses between structural features and ecological parameters

  • Experimental testing of chimeric proteins in different stress conditions

  • Directed evolution experiments under defined selective pressures

  • Computational modeling of protein dynamics in different environmental conditions

The correlation between structural variations and ecological niches suggests that igaA/yrfF has been fine-tuned to respond to specific environmental challenges encountered by different bacterial species, making it an excellent model for studying molecular adaptation.

What are promising strategies for targeting igaA/yrfF in antimicrobial development?

Given the essentiality of igaA/yrfF in important pathogens like E. coli and Salmonella, it represents a promising antimicrobial target. Several strategies merit investigation:

Potential Targeting Approaches:

  • Small molecule inhibitors targeting the hybrid SBB-2 domain to disrupt essential protein-protein interactions

  • Peptide mimetics based on conserved interaction interfaces

  • Allosteric modulators that lock igaA/yrfF in an inactive conformation, leading to lethal Rcs system activation

  • CRISPR-based antimicrobials targeting the igaA/yrfF gene

Methodological Development Path:

  • High-throughput screening against purified domains

  • Fragment-based drug discovery targeting specific binding pockets

  • Structure-based design informed by AlphaFold predictions

  • Whole-cell assays using reporter strains with Rcs-responsive elements

Considerations for Antimicrobial Development:

  • Specificity: Target conserved features unique to bacterial igaA/yrfF

  • Resistance potential: Monitor for compensatory mutations in Rcs components

  • Spectrum: Consider the differential essentiality across bacterial species

  • Delivery: Address challenges of targeting an inner membrane protein

How can functional studies of igaA/yrfF improve our understanding of bacterial stress responses?

The igaA/yrfF protein sits at a critical junction in bacterial envelope stress responses, making it valuable for understanding broader stress adaptation mechanisms:

Research Opportunities:

  • Use igaA/yrfF as a probe to understand how bacteria integrate different stress signals

  • Investigate cross-talk between Rcs and other stress response pathways

  • Develop igaA/yrfF variants as biosensors for specific envelope stresses

  • Explore the role of SBB domains as general signal transduction modules

Methodological Approaches:

  • Transcriptome and proteome profiling under various stress conditions with modified igaA/yrfF

  • Time-resolved studies of Rcs activation using fluorescent reporters

  • In vivo protein dynamics studies using fluorescence techniques

  • Interactome mapping under different stress conditions

Expected Insights:
Detailed studies of igaA/yrfF function could reveal fundamental principles of bacterial signal transduction, membrane protein function, and the evolution of stress response networks - all of which have implications beyond the Rcs system itself.

How might structural insights from igaA/yrfF inform studies of other membrane signal transduction systems?

The unique structural features of igaA/yrfF, particularly the arrangement of SBB domains at both sides of the membrane, provide a novel paradigm for membrane protein signal transduction:

Transferable Insights:

  • The hybrid SBB-2 domain model could represent a previously unrecognized signaling module

  • The mechanism of signal transduction across the membrane via conformational changes

  • The evolutionary flexibility of SBB domains as adaptable interaction platforms

  • The role of small β-barrels in protein-protein interactions at membrane interfaces

Methodological Translation:

  • Apply structure prediction approaches to other poorly characterized membrane regulators

  • Search for SBB-domain signatures in uncharacterized membrane proteins

  • Use the igaA/yrfF structure as a template for modeling related proteins

  • Develop generalizable assays for membrane protein signal transduction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.