Recombinant Escherichia coli Putative osmoprotectant uptake system permease protein yehW (yehW)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Escherichia coli Putative Osmoprotectant Uptake System Permease Protein YehW (yehW) is a membrane protein component of the YehZYXW ABC transporter complex. This system is implicated in low-affinity glycine betaine uptake under stress conditions but lacks osmoregulatory functions observed in related transporters like ProU . YehW functions as a permease, forming transmembrane channels for substrate translocation . Recombinant YehW is expressed in E. coli with a His-tag for purification and functional studies .

Substrate Specificity

YehW mediates low-affinity glycine betaine transport (KdK_d ≈ 2 mM) but shows no activity with proline, choline-O-sulfate, or other osmolytes . Key functional data:

AssayResultCitation
Osmoprotection assaysNo growth enhancement under hyperosmotic stress
Transport assaysGlycine betaine uptake inhibited at high salinity (KmK_m > 1 mM)
Genetic deletionNo phenotype under standard or osmotic stress conditions

Regulation

  • Transcriptionally activated by the general stress response sigma factor σ<sup>S</sup> (RpoS) .

  • Induced during stationary phase and nutrient limitation .

Recombinant Protein Expression

Recombinant YehW is produced in E. coli with the following specifications :

ParameterDetail
Host organismEscherichia coli
TagN-terminal His-tag
Protein lengthFull-length (1–243 aa)
Molecular weight~27 kDa
Purity>95% (SDS-PAGE verified)
ApplicationsStructural studies, transporter reconstitution, antibody production

Interaction Partners

YehW interacts with components of the YehZYXW transporter and other osmoregulatory systems :

ProteinRoleInteraction Score
YehXATPase subunit0.999
YehYPermease subunit0.995
YehZSubstrate-binding protein0.999
ProVProU system ATPase0.884
OsmFLow-affinity glycine betaine-binding protein0.999

Key Studies

  1. Low-Affinity Transport: YehZYXW transports glycine betaine with millimolar affinity, but uptake is inhibited at high salinity, suggesting non-osmoregulatory roles .

  2. Antivirulence Role: YehZYXW expression correlates with persistent, asymptomatic infections in murine models .

  3. Evolutionary Divergence: Phylogenetic analyses separate YehZYXW from canonical osmoprotectant transporters (e.g., ProU), supporting functional differentiation .

Applications

Recombinant YehW is utilized in:

  • Mechanistic studies of ABC transporter permease function.

  • Comparative analyses of stress response systems in Enterobacteriaceae.

  • Drug discovery targeting bacterial persistence mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your desired tag type at the time of order for preferential development.
Synonyms
yehW; b2128; JW2116; Glycine betaine uptake system permease protein YehW
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yehW
Target Protein Sequence
MKMLRDPLFWLIALFVALIFWLPYSQPLFAALFPQLPRPVYQQESFAALALAHFWLVGIS SLFAVIIGTGAGIAVTRPWGAEFRPLVETIAAVGQTFPPVAVLAIAVPVIGFGLQPAIIA LILYGVLPVLQATLAGLGAIDASVTEVAKGMGMSRGQRVRKVELPLAAPVILAGVRTSVI INIGTATIASTVGASTLGTPIIIGLSGFNTAYVIQGALLVALAAIIADRLFERLVQALSQ HAK
Uniprot No.

Target Background

Function
This protein is a component of an ABC transporter complex involved in low-affinity glycine betaine uptake. It is believed to facilitate substrate translocation across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is the YehZYXW system regulated in E. coli?

The YehZYXW system in E. coli is regulated by the general stress response sigma factor σs (RpoS). Transcription of the yehZYXW operon is activated under various stress conditions, including nutrient limitation, acidic pH, and hyperosmotic shock . This regulation pattern suggests the system plays a role in bacterial adaptation to environmental stresses. Understanding this regulatory mechanism is crucial for researchers designing experiments to study YehW function under different conditions.

What are effective methods for recombinant expression of YehW in E. coli?

For recombinant expression of YehW in E. coli, the T7 promoter system in pET vectors is highly recommended due to its efficiency. This system can yield target protein levels representing up to 50% of total cell protein in successful cases . A methodological approach includes:

  • Gene amplification: Amplify yehW by PCR from genomic DNA using primers that introduce appropriate restriction sites and tags (similar to the approach used for yehU/yehT studies ).

  • Vector construction: Clone the amplified gene into pET expression vectors (pMB1 origin, medium copy number) with the gene of interest placed behind the T7 promoter.

  • Expression strain: Transform into E. coli strains containing the λDE3 prophage encoding T7 RNA polymerase under control of an inducible promoter.

  • Expression conditions: Optimize induction parameters based on protein solubility testing, typically using IPTG at concentrations between 0.1-1.0 mM.

  • Growth conditions: For membrane proteins like YehW, lower induction temperatures (16-25°C) often improve proper folding and membrane integration.

This approach allows for controlled expression of the membrane-bound YehW protein while minimizing potential toxicity issues that can occur with membrane protein overexpression.

What strategies can be employed to verify the functional activity of recombinant YehW?

Verifying functional activity of recombinant YehW requires multiple complementary approaches:

  • Complementation assays: Transform yehW deletion strains with plasmids expressing recombinant YehW and assess restoration of phenotypes.

  • Transport assays: Measure uptake of potential substrates in reconstituted proteoliposomes containing purified YehW or in whole cells with controlled expression.

  • Interaction studies: Verify proper complex formation with other YehZYXW components using techniques such as:

    • Co-immunoprecipitation

    • Bacterial two-hybrid assays

    • Förster resonance energy transfer (FRET) with fluorescently tagged components

  • Stress response assays: Since YehW expression is linked to stress responses, test functionality by exposing cells to various stressors (nutrient limitation, pH changes, osmotic shock) and measuring survival rates in wild-type versus yehW mutant strains .

It's important to note that unlike classical osmoprotectant transporters, functional assays for YehW may not show clear osmoprotection effects based on recent findings questioning its role in conventional osmoprotection .

How can researchers effectively purify YehW for structural and biochemical studies?

Purification of YehW presents challenges typical of membrane proteins but can be achieved through this methodological approach:

  • Expression optimization:

    • Use E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

    • Employ controlled induction (lower IPTG concentrations, 0.1-0.3 mM)

    • Express at reduced temperatures (16-20°C) to improve proper folding

  • Membrane preparation:

    • Harvest cells and disrupt by French press or sonication

    • Isolate membrane fractions through differential centrifugation

    • Wash membranes to remove peripheral proteins

  • Solubilization screening:

    • Test multiple detergents (DDM, LMNG, DMNG) for optimal YehW extraction

    • Verify protein stability in selected detergents using thermal shift assays

  • Affinity purification:

    • Utilize hexahistidine tags (similar to the approach used for YehU/YehT )

    • Implement cobalt or nickel affinity chromatography with imidazole gradient elution

    • Include detergent in all purification buffers

  • Polishing steps:

    • Size exclusion chromatography to separate monomeric from oligomeric forms

    • Ion exchange chromatography for final purification

This protocol, adapted from successful approaches with similar membrane proteins, yields purified YehW suitable for structural and functional characterization.

How does YehW interact with other components of the YehZYXW system?

The functional architecture of the YehZYXW complex involves specific interactions between YehW and other system components:

  • YehW-YehY interface: As permease components, YehW and YehY form the central membrane-spanning channel. These proteins likely interact through transmembrane helices to create a substrate translocation pathway.

  • YehW-YehZ coupling: Research suggests a conformational coupling mechanism where substrate binding to YehZ triggers conformational changes transmitted to YehW. This coupling facilitates substrate transfer from the periplasmic binding protein (YehZ) to the membrane channel (YehW/YehY).

  • YehW-YehX energy coupling: The ATPase activity of YehX must be coupled to substrate translocation through YehW. This likely occurs through conserved coupling helices in YehW that interact with YehX.

Methodological approaches to study these interactions include:

  • Site-directed mutagenesis of key residues at predicted interfaces

  • Crosslinking studies with introduced cysteine residues

  • Cryo-electron microscopy of the assembled complex

  • Molecular dynamics simulations to model conformational changes

Understanding these interactions is crucial for elucidating the molecular mechanism of transport and substrate specificity of the entire YehZYXW system.

What is the physiological role of the YehZYXW system in E. coli stress response?

Evidence suggests that the YehZYXW system plays a nuanced role in stress response that differs from classical osmoprotectant transporters:

  • Stress activation pattern: The YehZYXW system is transcriptionally activated by σs under various stress conditions including nutrient limitation, acidic pH, and hyperosmotic shock .

  • Limited osmoprotection function: Unlike typical osmoprotectant transporters, YehZ shows only very low-affinity binding to glycine betaine (Kd ~2 mM) and deletion of yehZ does not reduce protection against hyperosmotic shock in the presence of glycine betaine .

  • Alternative stress functions: In S. enterica, a ΔyehZ strain shows growth advantages in standard media and enhanced replication in macrophages, suggesting potential roles in:

    • Adaptation to nutrient limitation

    • Regulation of growth during stationary phase

    • Modulation of pathogen-host interactions

Methodological approaches to investigate this question include:

  • Transcriptomic profiling of wild-type vs. yehZYXW deletion strains under various stressors

  • Metabolomic analysis to identify accumulated or depleted metabolites in mutant strains

  • Competitive fitness assays under different stress conditions

  • Infection models to assess roles in host-pathogen interactions

The precise role remains an active area of investigation, with evidence pointing toward functions beyond classical osmoprotection.

How does the YehZYXW system compare to other osmoprotectant transporters in bacteria?

The YehZYXW system shows both similarities and notable differences compared to established osmoprotectant transporters:

FeatureYehZYXW SystemClassical Osmoprotectant Transporters (e.g., ProU)
StructureABC transporter with PBP (YehZ)ABC transporters with specific PBPs
Substrate affinityVery low affinity for glycine betaine (Kd ~2 mM) High affinity (μM range) for osmoprotectants
OsmoprotectionLimited or no demonstrable osmoprotection Strong osmoprotection phenotypes
Regulationσs-dependent, activated by multiple stresses Primarily osmolarity-responsive
PhylogenyYehZ forms distinct clade from osmoprotectant PBPs Clear evolutionary relationship among osmoprotectant PBPs
Function in vivoUnclear, potentially beyond osmoprotectionWell-established osmoprotectant uptake

This comparative analysis suggests that despite structural similarities to osmoprotectant transporters, the YehZYXW system likely evolved for different physiological functions. Researchers should be cautious about assuming functional equivalence based solely on structural homology.

What insights can be gained from studying YehW homologs in other bacterial species?

Studying YehW homologs across bacterial species provides valuable evolutionary and functional insights:

Methodological approaches for comparative studies include:

  • Phylogenetic analysis of YehW sequences across bacterial species

  • Heterologous expression of YehW homologs in E. coli yehW deletion strains

  • Transcriptomic and phenotypic analysis of deletion mutants in diverse species

  • Structure-function analysis of conserved vs. variable domains

These comparative studies can reveal evolutionary adaptations of the system and provide insights into bacterial stress response mechanisms across species.

What are the major challenges in studying YehW function and how can they be addressed?

Researchers face several technical challenges when studying YehW:

  • Membrane protein expression issues:

    • Challenge: Toxic effects of membrane protein overexpression

    • Solution: Use tunable expression systems with lower induction levels and specialized E. coli strains (C41/C43) designed for membrane protein expression

  • Complex formation requirements:

    • Challenge: YehW likely functions as part of a multi-component complex

    • Solution: Co-express all components of the YehZYXW system or use in vivo assays where native partners are present

  • Substrate identification difficulties:

    • Challenge: The natural substrate(s) remain unidentified or controversial

    • Solution: Employ unbiased metabolomics approaches coupled with transport assays using radiolabeled candidate substrates

  • Functional redundancy:

    • Challenge: Potential functional overlap with other transporters masks phenotypes

    • Solution: Generate multiple deletion strains lacking redundant systems and use synthetic genetic array analysis to identify genetic interactions

  • Assay development:

    • Challenge: Lack of clear functional assays due to uncertain physiological role

    • Solution: Develop high-throughput screening methods to test diverse conditions and potential substrates

These methodological solutions can help overcome the inherent difficulties in studying membrane transporters with unclear physiological functions.

How can researchers distinguish between direct and indirect effects when studying YehW mutant phenotypes?

Distinguishing direct from indirect effects requires rigorous experimental design:

  • Complementation controls:

    • Express wild-type YehW in deletion strains to verify phenotype rescue

    • Use point mutants affecting specific functions (e.g., substrate binding vs. conformational changes) to dissect mechanism

  • Temporal analysis:

    • Monitor rapid responses (seconds to minutes) which likely represent direct effects

    • Compare with delayed responses (hours) which may indicate indirect transcriptional or metabolic adaptations

  • Biochemical verification:

    • Demonstrate direct substrate binding or transport in purified systems

    • Use reconstituted proteoliposomes containing only YehZYXW components

  • Multi-omics approach:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Construct regulatory network models to distinguish primary from secondary effects

  • Synthetic genetic arrays:

    • Systematically combine yehW deletion with other mutations

    • Identify synthetic phenotypes revealing functional relationships

This comprehensive approach can help delineate the direct physiological functions of YehW from secondary adaptations or compensatory mechanisms.

What emerging technologies could advance our understanding of YehW function?

Several cutting-edge technologies hold promise for elucidating YehW function:

  • Cryo-electron microscopy:

    • High-resolution structural analysis of the complete YehZYXW complex

    • Visualization of conformational changes during transport cycle

  • Single-molecule techniques:

    • FRET-based approaches to monitor conformational dynamics in real-time

    • Microfluidic-based single-cell analysis of transport activities

  • Integrative structural biology:

    • Combining X-ray crystallography, NMR, and molecular dynamics simulations

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

  • Metabolomics and chemical biology:

    • Untargeted metabolomics to identify physiological substrates

    • Activity-based protein profiling to identify interacting molecules

  • CRISPR-based technologies:

    • CRISPRi for tunable repression to study dosage effects

    • CRISPR-based screening to identify genetic interactions

  • Microfluidic evolution devices:

    • Continuous culture under defined selective pressures

    • Real-time monitoring of adaptive mutations affecting YehW function

These emerging approaches can overcome limitations of traditional techniques and provide new insights into the molecular function of YehW.

What are the most important unresolved questions regarding YehW and the YehZYXW system?

Several fundamental questions remain unanswered regarding YehW function:

  • Substrate specificity:

    • What are the natural substrate(s) of the YehZYXW system?

    • Why does YehZ show only very low affinity for glycine betaine despite structural similarity to osmoprotectant transporters?

  • Physiological role:

    • What is the primary biological function if not conventional osmoprotection?

    • How does it contribute to stress adaptation or stationary phase survival?

  • Regulatory integration:

    • How is YehZYXW activity integrated with other stress response systems?

    • What are the downstream effects of YehZYXW activation?

  • Structural mechanisms:

    • How do conformational changes couple ATP hydrolysis to substrate translocation?

    • What determines substrate selectivity at the molecular level?

  • Evolutionary significance:

    • Why is this system conserved across diverse bacterial species?

    • How has its function diverged in different ecological niches?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and systems biology to fully understand this enigmatic transport system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.