Recombinant Escherichia coli Putative permease perM (perM)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of PerM

PerM is a putative inner membrane permease belonging to the UPF0118 family. Its gene, perM, is located in the E. coli K-12 genome and encodes a 353-amino-acid protein with a molecular weight of approximately 40 kDa . Key features include:

PropertyDetail
Gene IDperM (yfgO, ECK2489, JW2478)
Protein FamilyUPF0118 family
FunctionPredicted inner membrane transporter; role in substrate translocation
Structural FeaturesMultiple transmembrane domains; N-terminal His-tag in recombinant forms
Host SystemsE. coli, yeast, baculovirus, mammalian cells

While its exact physiological substrate remains unconfirmed, homology to other permeases suggests involvement in small-molecule transport .

Recombinant Expression Systems

Recombinant PerM is typically expressed in E. coli with an N-terminal His-tag for purification. Key expression platforms include:

  • pET-28a plasmid vectors: Used for high-yield cytoplasmic expression in E. coli BL21(DE3) .

  • Tunable promoters: Systems like the rhamnose promoter enable adjustable production rates, optimizing periplasmic yields .

  • Cell-free systems: Alternative platforms for producing tag-free variants .

Expression Optimization Insights:

  • Strains from the E. coli Reference (ECOR) collection show variable heterologous protein expression efficiency, with some strains achieving 250–500× higher yields than others .

  • Signal peptides (e.g., DsbA, OmpA) enhance periplasmic localization, critical for disulfide bond formation .

Binding and Transport Mechanisms

PerM shares functional parallels with other E. coli transporters like the Dpp permease, which uses ATP-binding cassette (ABC) transporters and periplasmic binding proteins (e.g., DppA, MppA) for substrate translocation . Although PerM’s substrate specificity is unconfirmed, competition assays suggest it may interact with peptides or heme derivatives .

Proteomic Adaptability

E. coli modulates its translocation machinery (e.g., SecA, YidC) under recombinant protein production stress, potentially enhancing PerM expression efficiency .

Challenges and Future Directions

  • Substrate Identification: Functional assays (e.g., radiolabeled uptake studies) are needed to elucidate PerM’s role.

  • Expression Strain Optimization: Leveraging ECOR strain diversity could improve yield .

  • Structural Resolution: High-resolution structures would clarify transport mechanisms.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
perM; yfgO; b2493; JW2478; Putative permease PerM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
perM
Target Protein Sequence
MLEMLMQWYRRRFSDPEAIALLVILVAGFGIIFFFSGLLAPLLVAIVLAYLLEWPTVRLQ SIGCSRRWATSIVLVVFVGILLLMAFVVLPIAWQQGIYLIRDMPGMLNKLSDFAATLPRR YPALMDAGIIDAMAENMRSRMLTMGDSVVKISLASLVGLLTIAVYLVLVPLMVFFLLKDK EQMLNAVRRVLPRNRGLAGQVWKEMNQQITNYIRGKVLEMIVVGIATWLGFLLFGLNYSL LLAVLVGFSVLIPYIGAFVVTIPVVGVALFQFGAGTEFWSCFAVYLIIQALDGNLLVPVL FSEAVNLHPLVIILSVVIFGGLWGFWGVFFAIPLATLIKAVIHAWPDGQIAQE
Uniprot No.

Target Background

Database Links
Protein Families
Autoinducer-2 exporter (AI-2E) (TC 2.A.86) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the putative permease perM in Escherichia coli and how does it relate to other bacterial permeases?

Putative permease perM belongs to a family of membrane transport proteins in E. coli that facilitate the movement of specific molecules across the cell membrane. While perM specifically isn't detailed in the available literature, we can understand its potential function by examining other characterized permeases in E. coli. For instance, E. coli utilizes multiple permeases for peptidoglycan (PG) recycling, including AmpG and the oligopeptide permease (Opp) system that works with the PG-specific periplasmic binding protein MppA . These permeases are differentially regulated based on environmental conditions and serve distinct but complementary functions in bacterial cell wall maintenance.

Methodological approach: To characterize a putative permease like perM, researchers should employ a combination of bioinformatic analysis (sequence homology, structural prediction), gene expression studies under various conditions, and functional assays using knockout mutants compared to wild-type strains.

How do researchers determine the substrate specificity of perM?

Determining substrate specificity for bacterial permeases involves multiple complementary approaches:

  • In silico analysis: Sequence comparison with permeases of known specificity to identify conserved binding domains

  • Transport assays: Measuring uptake of radiolabeled or fluorescently labeled candidate substrates

  • Growth complementation: Testing if perM expression rescues growth defects in strains lacking specific transport capabilities

  • Competition assays: Examining if unlabeled potential substrates compete with transport of known substrates

For example, researchers studying the MppA/Opp permease system determined its specificity for muropeptides by demonstrating its "unique capability of high-affinity scavenging of muropeptides from growth media" .

What experimental controls are essential when studying perM function?

Control TypePurposeImplementation
Negative controlsEstablish baseline/backgroundEmpty vector transformants; perM knockout strains
Positive controlsValidate assay functionalityKnown permease with similar function; complemented knockout
Expression controlsVerify protein productionWestern blot; fluorescent tagging; RT-qPCR
Specificity controlsConfirm substrate selectivityStructurally similar non-substrate molecules; competitive inhibition
Environmental controlsAccount for condition variablesStandardized media, temperature, pH, and growth phase

Methodological consideration: When designing experiments involving membrane proteins like permeases, researchers must verify proper membrane localization of the recombinant protein, as mislocalization can lead to false negative results in functional assays .

How should researchers design experiments to investigate perM regulation in response to environmental factors?

Based on findings with other E. coli permeases, perM expression may be differentially regulated by environmental factors such as carbon source and growth phase . To investigate this:

  • Design a factorial experiment manipulating multiple environmental variables (carbon source, nitrogen availability, oxygen levels, growth phase)

  • Measure perM expression using transcriptional fusions (e.g., perM promoter-reporter constructs)

  • Validate findings with RT-qPCR and protein quantification

  • Compare expression patterns with those of known permeases under identical conditions

The experimental design should include randomization, appropriate replication, and controls for extraneous variables that might influence gene expression . For instance, when studying AmpG and MppA/Opp permeases, researchers discovered "AmpG and MppA/Opp are differentially regulated by carbon source and growth phase" , demonstrating how environmental context affects permease utilization.

What approaches can researchers use to determine the transport kinetics of perM?

Transport kinetics analysis for permeases requires specialized techniques to quantify substrate movement across membranes:

  • Whole-cell assays: Measuring substrate uptake rates in intact cells expressing perM

  • Membrane vesicle preparations: Inside-out or right-side-out vesicles to study directional transport

  • Proteoliposome reconstitution: Purified perM incorporated into artificial membrane systems

  • Electrophysiological methods: Patch-clamp or black lipid membrane techniques for electrically coupled transport

For each approach, substrate concentration should be systematically varied to determine kinetic parameters (Km, Vmax). Analysis should account for nonspecific binding and passive diffusion. When designing such experiments, researchers should follow systematic procedures that allow for meaningful comparison of responses across experimental conditions while maintaining flexibility to explore unexpected findings .

How can researchers effectively isolate and purify recombinant perM for structural studies?

Membrane protein purification presents unique challenges due to their hydrophobicity and requirement for a lipid environment:

  • Expression optimization: Test multiple expression systems (E. coli strains, vectors, induction conditions) to maximize yield while maintaining protein folding

  • Membrane extraction: Carefully select detergents that efficiently solubilize membranes while preserving protein structure

  • Affinity purification: Incorporate purification tags (His, FLAG, Strep) positioned to minimize interference with protein function

  • Size exclusion chromatography: Remove aggregates and ensure sample homogeneity

  • Stability assessment: Monitor protein stability through various biophysical techniques (circular dichroism, fluorescence spectroscopy)

Researchers should validate that purified perM retains functionality through activity assays before proceeding to structural studies.

What are the most effective methods for generating perM knockout mutants in E. coli?

Creating precise genetic modifications requires selecting appropriate techniques based on research goals:

  • λ Red recombination: Facilitates precise gene deletion with minimal polar effects by replacing the target gene with an antibiotic resistance cassette

  • CRISPR-Cas9 genome editing: Enables marker-free deletions or point mutations with high specificity

  • Transposon mutagenesis: Useful for generating random insertions for screening phenotypes

  • Allelic exchange: Two-step process allowing clean deletions without antibiotic markers

After generating mutants, comprehensive verification should include:

  • PCR confirmation of the deletion

  • Whole-genome sequencing to check for off-target effects

  • Complementation tests to verify phenotypes are specifically due to perM loss

  • Expression analysis of neighboring genes to rule out polar effects

These approaches align with experimental design principles that emphasize systematic testing of hypotheses through controlled manipulation of variables .

How can researchers create reporter systems to study perM expression patterns?

To investigate the regulation and expression patterns of perM:

  • Transcriptional fusions: Create perM promoter-reporter gene fusions (GFP, lacZ, luciferase) to monitor promoter activity

  • Translational fusions: Generate in-frame fusions between perM and reporter genes to track protein production and localization

  • Dual reporter systems: Employ two different reporters to simultaneously monitor transcription and translation

  • Native locus tagging: Introduce reporter tags into the chromosomal perM locus to maintain native regulation

When analyzing expression data, researchers should employ appropriate statistical methods and account for variations in cell growth rates, reporter protein stability, and cellular autofluorescence.

How can transcriptomic approaches elucidate perM's role in cellular networks?

Modern transcriptomic techniques offer powerful ways to understand permease function in broader cellular contexts:

  • RNA-Seq analysis comparing wild-type and perM mutants under various conditions

  • Time-course experiments to capture dynamic expression changes

  • Single-cell transcriptomics to assess population heterogeneity

  • Network analysis to identify co-regulated genes and regulatory factors

These approaches can reveal how perM expression correlates with other cellular processes, similar to studies showing that different permease systems in E. coli (like AmpG and MppA/Opp) respond differently to environmental changes .

What bioinformatic approaches can predict functional partners of perM?

Computational methods can provide valuable insights into permease function:

  • Co-expression analysis: Identifying genes with similar expression patterns across conditions

  • Phylogenetic profiling: Finding genes with similar patterns of presence/absence across species

  • Protein-protein interaction predictions: Computational docking and interaction site analysis

  • Pathway enrichment analysis: Determining if perM is associated with specific metabolic or signaling pathways

Researchers should validate computational predictions with experimental approaches like co-immunoprecipitation, bacterial two-hybrid assays, or crosslinking studies.

How does perM function contribute to E. coli's ecological adaptations?

Understanding the ecological context of permease function requires investigating their role in natural environments:

  • Competition experiments in mixed bacterial communities

  • Growth assays under nutrient limitation conditions

  • Biofilm formation assessment with perM mutants

  • Survival studies under various stresses (pH, temperature, antimicrobials)

Such approaches can reveal specialized functions similar to how MppA/Opp was found to be "uniquely capable of high-affinity scavenging of muropeptides from growth media," suggesting it allows E. coli to recapture materials released by neighboring bacteria in mixed communities .

What is the role of perM in bacterial interactions with host organisms?

For potentially pathogenic E. coli strains, permease function may impact host-pathogen interactions:

  • Colonization assays comparing wild-type and perM mutants

  • Analysis of perM expression during infection

  • Investigation of perM contribution to antimicrobial resistance

  • Assessment of immune response to perM-deficient strains

Similar to how peptidoglycan recycling permeases affect the release of immunostimulatory cell wall fragments that can trigger inflammation , perM might influence host-pathogen interactions through its transport activities.

How can researchers address inconsistent or contradictory results in perM functional studies?

When faced with inconsistent results:

  • Systematically evaluate experimental variables (strain backgrounds, growth conditions, assay methods)

  • Verify protein expression and proper membrane localization

  • Assess genetic stability of constructs and potential suppressor mutations

  • Consider post-translational modifications or regulatory factors

An experimental design that incorporates controls for extraneous variables and potential confounding factors is essential for resolving contradictory findings .

What are the common pitfalls in membrane protein expression and how can they be overcome?

Common challenges in expressing membrane proteins like permeases include:

  • Toxicity from overexpression: Use tightly regulated, tunable expression systems

  • Protein misfolding: Optimize growth temperature, consider fusion partners, or employ specialized E. coli strains

  • Inclusion body formation: Test various solubilization and refolding protocols

  • Poor membrane integration: Verify signal sequence functionality and membrane targeting

Qualitative research approaches can help identify suitable conditions through iterative optimization, similar to the collaborative research methods described for public health research .

How might structural biology techniques advance understanding of perM function?

Cutting-edge structural biology approaches for membrane proteins include:

  • Cryo-electron microscopy for high-resolution structure determination

  • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

  • Solid-state NMR for studying membrane-embedded proteins

  • Molecular dynamics simulations to model substrate interactions and transport mechanisms

These techniques could reveal mechanistic details of substrate binding and translocation, similar to how understanding of other permeases has advanced through structural studies.

What emerging technologies might transform research on bacterial permeases like perM?

Innovative approaches with potential to advance permease research include:

  • Nanopore-based single-molecule transport assays

  • Microfluidic systems for high-throughput functional screening

  • Optogenetic tools for temporal control of permease expression

  • Genome-wide CRISPR screens to identify genetic interactions

These methods align with the systematic approach to testing hypotheses described in experimental design principles and could reveal unexpected aspects of permease function in bacterial physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.