Recombinant Escherichia coli Putative protein fhiA (fhiA)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Escherichia coli putative protein FhiA (fhiA) is a flagellar system protein critical for the structural assembly and export machinery of bacterial flagella . It is a 697-amino-acid protein encoded by the lfhA gene (UniProt ID: Q47153) and belongs to the FHIPEP (flagella/HR/invasion proteins export pore) family . FhiA plays a role in forming the rod structure of the flagellar apparatus and collaborates with FliI and FliH to facilitate flagellin export . This protein has been recombinantly expressed in E. coli with a His tag for purification and functional studies .

Recombinant Expression and Purification

Recombinant FhiA is produced in E. coli using plasmid-based expression systems. Key steps include :

  1. Expression: Induced under optimized conditions to maximize soluble protein yield.

  2. Purification: His-tag affinity chromatography followed by buffer exchange.

  3. Quality Control: Confirmed via SDS-PAGE (>90% purity) and mass spectrometry.

Critical Notes:

  • Repeated freeze-thaw cycles degrade the protein; aliquoting is recommended .

  • Reconstitution in deionized water with glycerol (5–50%) enhances long-term stability .

Functional Role in Flagellar Assembly

FhiA is essential for constructing the flagellar rod, a basal body component that connects the motor to the filament. Key functional insights include:

  • Export Apparatus: Collaborates with FliI (ATPase) and FliH (regulator) to form the type III secretion system (T3SS) for flagellin export .

  • Genetic Interactions: Knockout strains show defective flagellar assembly and motility .

Protein Interaction Network

FhiA interacts with multiple flagellar export/assembly proteins, as identified in the STRING database :

Table 2: Predicted Functional Partners of FhiA

Interacting ProteinFunctionInteraction Score
LfhBLateral flagellar export/assembly (FlhB-like transporter)0.987
LfiRFlagellar biosynthesis (FliR/MopE/SpaR family)0.986
LfiPFlagellar export (FliP-like component of T3SS)0.984
LfiNMotor switch complex (C-ring assembly)0.977

These interactions highlight FhiA’s central role in coordinating flagellar biogenesis .

Applications and Research Implications

  • Flagellar Studies: Used to dissect molecular mechanisms of bacterial motility and virulence .

  • Protein Engineering: Serves as a template for optimizing recombinant protein export systems in E. coli .

  • Biotechnological Tools: His-tagged FhiA enables structural studies (e.g., cryo-EM) to resolve flagellar assembly dynamics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us and we will prioritize its development.
Synonyms
lfhA; fhiA; b0229; JW5811; Putative truncated flagellar export/assembly protein LfhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-579
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
lfhA
Target Protein Sequence
MLSRSDLLTLLTINFIVVTKGAERISEVSARFTLDAMPGKQMAIDADLNAGLINQAQAQT RRKDVASEADFYGAMDGASKFVRGDAIAGMMILAINLIGGVCIGIFKYNLSADAAFQQYV LMTIGDGLVAQIPSLLLSTAAAIIVTRVSDNGDIAHDVRNQLLASPSVLYTATGIMFVLA VVPGMPHLPFLLFSALLGFTGWRMSKQPLAAEAEEKSLETLTRTITETSEQQVSWETIPL IEPISLSLGYKLVALVDKAQGNPLTQRIRGVRQVISDGNGVLLPEIRIRENFRLKPSQYA IFINGIKADEADIPADKLMALPSSETYGEIDGVQGNDPAYGMPVTWIQAAQKAKALNMGY QVIDSASVIATHVNKIVRSYIPDLFNYDDITQLHNRLSSTAPRLAEDLSAALNYSQLLKV YRALLTEGVSLRDIVTIATVLVASSTVTKDHILLAADVRLALRRSITHPFVRKQELTVYT LNNELENLLTNVVNQAQQGGKVMLDSVPVDPNMLNQFQSTMPQVKEQMKAAGKDPVLLVP PQLRPLLARYARLFAPGLHVLSYNEVPDELELKIMGALM
Uniprot No.

Target Background

Protein Families
FHIPEP (flagella/HR/invasion proteins export pore) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the putative protein fhiA in E. coli and how does it relate to characterized proteins?

The putative protein fhiA in E. coli likely belongs to the family of forkhead-associated domain-containing proteins, similar to FhaA found in mycobacteria. Based on comparable proteins, fhiA may play a role in cell division, cell wall synthesis, or maintenance of cell envelope integrity. In mycobacteria, FhaA interacts with penicillin binding protein A (PbpA), a peptidoglycan biosynthesis enzyme, suggesting it has a critical role in cell wall development . FhaA depletion leads to accumulation of peptidoglycan precursors at the septum and poles, resulting in altered cell morphology . By analogy, fhiA may have similar functions in E. coli's cellular processes.

What expression systems are most effective for recombinant fhiA production?

While E. coli remains the dominant expression system for recombinant proteins (approximately 60% of all expression studies) , researchers should consider multiple expression platforms for fhiA:

Expression SystemAdvantagesConsiderations for fhiA
E. coli BL21(DE3)High yield (≈30mg/L culture), rapid growth, simple purificationPotential for inclusion bodies if fhiA affects cell wall integrity
pPROEX-1 vector with His-tagSingle-step purification (≈80% yield), stable protein (stable for 18 months at -20°C with 25% glycerol)Tag may need removal via TEV protease for functional studies
Yeast (S. cerevisiae, P. pastoris)Better for complex proteins, post-translational modifications, high biomass yieldConsider for fhiA if E. coli expression is problematic

For optimal expression in E. coli, consider using a 6×His-tag system with a protease cleavage site, similar to the "H6TV" fusion approach used for Fhit protein expression .

What are typical protein purification yields for recombinant fhiA?

Based on similar recombinant protein expression studies in E. coli, researchers can expect:

  • Approximately 30 mg of His-tagged protein from 1 L of cell culture (≈4 g of cells) when expressed for 3 hours at 37°C

  • Purification yields of approximately 80% using nickel-nitrilotriacetate resin with imidazole elution

  • Protein stability for approximately 3 weeks at 4°C without activity loss, or 18+ months at -20°C when stored in buffer containing 25% glycerol

How can protein-protein interactions of fhiA be characterized in the context of cell division?

Based on studies of similar proteins like FhaA, researchers should consider that fhiA likely engages in functional protein-protein interactions critical to its role in cell division or cell wall synthesis. The identification of PbpA as an interaction partner for FhaA in mycobacteria provides insight into potential fhiA interactions in E. coli .

Methodological approaches for characterizing these interactions include:

  • Co-immunoprecipitation with tagged fhiA followed by mass spectrometry

  • Bacterial two-hybrid screening against an E. coli genomic library

  • Proximity-dependent biotin labeling (BioID) to identify transient interactors

  • Fluorescence resonance energy transfer (FRET) for direct visualization of interactions

To validate interactions, researchers should examine protein expression levels in wild-type versus mutant backgrounds, as seen with PbpA levels in FhaA mutants, where a drastic reduction in ectopically expressed PbpA was observed in the ΔfhaA strain compared to wild-type .

What phenotypic changes result from fhiA deletion or mutation?

Based on FhaA studies in mycobacteria, researchers can anticipate that fhiA deletion or mutation in E. coli may result in:

  • Altered cell morphology - potentially shorter cell length phenotype due to defects in cell elongation/cell wall synthesis

  • Accumulation of peptidoglycan precursors at the septum and poles

  • Increased sensitivity to multiple classes of antibiotics indicating general permeability defects

  • Potential growth defects under specific environmental conditions

To characterize these phenotypes, researchers should perform:

  • Scanning electron microscopy for detailed morphological analysis

  • Fluorescent D-amino acid labeling to visualize peptidoglycan synthesis patterns

  • Antibiotic susceptibility testing across multiple drug classes

  • Growth curve analysis under varying conditions (temperature, pH, osmotic stress)

How do structural features of fhiA contribute to its function?

The forkhead-associated domain in fhiA likely functions as a phosphopeptide recognition module that mediates protein-protein interactions through binding to phosphothreonine-containing motifs. This domain architecture would allow fhiA to participate in signaling networks related to cell division or stress response.

Structural characterization approaches should include:

  • X-ray crystallography of the purified protein

  • Site-directed mutagenesis of conserved residues in the forkhead domain

  • Molecular dynamics simulations to model binding with potential interaction partners

  • Isothermal titration calorimetry to determine binding affinities with peptide substrates

What is the optimal cloning and expression strategy for producing functional recombinant fhiA?

Based on successful approaches with similar proteins, a recommended workflow includes:

  • Gene cloning: Insert the fhiA gene into the pPROEX-1 vector with an N-terminal His-tag and TEV protease cleavage site

  • Expression conditions: Transform into BL21(DE3) cells and induce with IPTG (0.5-1 mM) for 3-4 hours at 30-37°C

  • Purification: Use nickel-nitrilotriacetate resin with imidazole gradient elution (50-250 mM)

  • Tag removal: Incubate with TEV protease at 4°C for 24 hours for complete cleavage of the His-tag

  • Storage: Store in buffer containing 25% glycerol at -20°C for long-term stability

For challenging expressions, consider co-expression with molecular chaperones or using yeast expression systems which may provide better protein folding for complex proteins like fhiA .

How can researchers effectively design knockout studies to assess fhiA function?

To investigate fhiA function through knockout studies:

  • Generate a precise deletion using CRISPR-Cas9 or lambda Red recombination system

  • Create a complementation strain by reintroducing the wild-type fhiA gene on a plasmid

  • Include controls with both homologous genes (e.g., from E. coli) and orthologous genes (e.g., M. tuberculosis fhaA) to test functional conservation

  • Analyze multiple phenotypic parameters:

    • Growth rates in different media

    • Cell morphology using microscopy

    • Antibiotic sensitivity profiles

    • Cell envelope integrity using dye penetration assays

When analyzing phenotypes, researchers should be aware that FhaA deletion in mycobacteria resulted in a short cell length phenotype that was reversed by complementation with both M. smegmatis and M. tuberculosis fhaA genes, confirming their functional conservation .

What approaches can be used to determine the subcellular localization of fhiA?

To determine the subcellular localization of fhiA protein:

  • Fluorescent protein fusion: Create C-terminal or N-terminal GFP fusions ensuring functional integrity

  • Immunofluorescence microscopy: Develop specific antibodies against fhiA for native protein localization

  • Cell fractionation: Separate cytoplasmic, membrane, and periplasmic fractions followed by western blot analysis

  • Time-lapse microscopy: Visualize dynamic localization during cell cycle progression

Based on FhaA's role in mycobacteria, particular attention should be paid to localization at the septum and poles, where peptidoglycan precursors were observed to accumulate upon FhaA depletion .

How can researchers distinguish between direct and indirect effects in fhiA functional studies?

To distinguish between direct and indirect effects:

  • Conduct epistasis analysis with known cell division and cell wall synthesis genes

  • Perform site-directed mutagenesis of key residues in the forkhead-associated domain

  • Use inducible expression systems to create depletion strains rather than complete knockouts

  • Combine genetic approaches with biochemical assays to demonstrate direct interactions

When interpreting results, consider that a deletion mutant of fhaA in M. smegmatis showed multiple phenotypes including altered cell length and increased antibiotic sensitivity, suggesting both specific and general effects on cell envelope integrity .

What statistical approaches are most appropriate for analyzing fhiA phenotypic data?

For robust statistical analysis of fhiA phenotypic data:

  • Use functional data analysis (FDA) for time-series data from growth or expression studies

  • Implement multivariate methods for complex phenotypic datasets with multiple parameters

  • Consider split-plot experimental designs when testing multiple factors (e.g., genetic background, environmental conditions)

  • Use R software for statistical analysis, which has been identified as most compatible with FDA methodology

A comparison between different statistical methodologies is important as initial results may indicate no significant main effects when using FDA alone, while different methodologies may reveal similar behaviors for main effect estimates .

How should conflicting experimental results regarding fhiA function be reconciled?

When confronted with conflicting results:

  • Examine genetic background differences between strains used

  • Consider growth conditions and expression levels that may affect phenotypes

  • Evaluate the sensitivity and specificity of different assay methods

  • Perform complementation studies with both native fhiA and orthologous genes

  • Use multiple experimental approaches to cross-validate findings

As demonstrated with FhaA studies, complementation with both M. smegmatis and M. tuberculosis fhaA genes reversed the mutant phenotype, confirming their association with the observed phenotype despite being from different species .

How might fhiA research contribute to understanding antibiotic resistance mechanisms?

Research into fhiA function could provide valuable insights into intrinsic antibiotic resistance mechanisms:

  • FhaA deletion mutants showed increased sensitivity to multiple antibiotic classes, suggesting a role in maintaining cell envelope integrity

  • If fhiA has similar functions in E. coli, it may contribute to intrinsic resistance by affecting peptidoglycan structure or permeability

  • Understanding fhiA's interaction with PbpA-like proteins could illuminate mechanisms of β-lactam resistance

  • The identification of fhiA as potentially involved in cell envelope maintenance suggests it could be a novel target for combination therapies to enhance antibiotic efficacy

What technological advances would facilitate better characterization of fhiA function?

Emerging technologies that would enhance fhiA research include:

  • Cryo-electron tomography for visualizing subcellular localization in near-native state

  • Single-molecule tracking to observe dynamic behavior during cell division

  • Metabolic labeling combined with click chemistry to track peptidoglycan incorporation

  • AlphaFold or similar AI-based structural prediction tools to model protein interactions

  • CRISPRi for fine-tuned regulation of fhiA expression rather than complete knockout

How can comparative genomics inform understanding of fhiA evolution and function?

Comparative genomics approaches for fhiA research should include:

  • Analysis of fhiA conservation across diverse bacterial species

  • Identification of co-evolved gene clusters that may function with fhiA

  • Examination of fhiA variants in clinical E. coli isolates with varying antibiotic resistance profiles

  • Ancestral reconstruction to understand the evolutionary trajectory of fhiA function

Such analyses could reveal whether the functional relationship between FhaA and peptidoglycan synthesis observed in mycobacteria is conserved in enterobacteria like E. coli, providing evolutionary context for this important cellular process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.