Recombinant Escherichia coli Putative type II secretion system L-type protein YghE (yghE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
yghE; b2969; Putative type II secretion system L-type protein YghE; Putative general secretion pathway L-type protein YghE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yghE
Target Protein Sequence
MIHQQHMRNIAQWLQENGITRATVAPDWMSIPCGFMACDAQRVICRIDECRGWSAGLALA PVMFRAQLNEQDLPLSLTVVGIAPEKLSAWAGADAERLTVTALPAITTYGEPEGNLLTGP WQPRVSYRKQWARWRVMILPILLILVALAVERGVTLWSVSEQVAQSRTQAEEQFLTLFPE QKRIVNLRSQVTMALKKYRPQADDTRLLAELSAIASTLKSASLSDIEMRGFTFDQKRQIL HLQLRAANFASFDKLRSVLATDYVVQQDALQKEGDAVSGGVTLRRK
Uniprot No.

Target Background

Function

Involved in type II secretion systems (T2SS, formerly known as the general secretion pathway, GSP) for the export of folded proteins across the outer membrane.

Protein Families
GSP L family
Subcellular Location
Cell inner membrane.

Q&A

What is the Type II Secretion System in E. coli and what role does YghE play in it?

The Type II Secretion System (T2SS) is a complex multi-protein machinery used by Gram-negative bacteria, including E. coli, to transport proteins from the periplasmic space across the outer membrane to the extracellular environment. In E. coli, multiple T2SS clusters have been identified, with the Gsp system (also called T2SS H10407 in some strains) being one of the most well-characterized .

YghE is a putative L-type protein component of the T2SS machinery, likely playing a structural role in the secretion apparatus. The T2SS consists of multiple proteins that form different parts of the secretion machinery, including pseudopilins, a secretin (outer membrane channel), and inner membrane platform proteins. L-type proteins are generally involved in connecting different parts of the machinery, particularly between the inner membrane platform and the pseudopilus structure.

The T2SS in E. coli has been demonstrated to secrete various proteins, most notably the heat-labile enterotoxin (LT) in enterotoxigenic E. coli (ETEC) and the surface-associated lipoprotein SslE (formerly known as YghJ) which contributes to biofilm formation in enteropathogenic E. coli (EPEC) .

Which E. coli strains are most suitable for expressing recombinant YghE protein?

For expressing recombinant YghE protein, BL21(DE3) and its derivatives are generally the most suitable E. coli strains. BL21(DE3) contains a chromosomally integrated copy of the T7 RNA polymerase gene under control of the lacUV5 promoter, which provides high-level, controlled expression of proteins cloned under T7 promoters .

When selecting a strain for YghE expression, consider the following factors:

  • Expression level requirements: BL21(DE3) provides high-level expression but may lead to inclusion body formation for membrane-associated proteins like YghE.

  • Protein folding considerations: For membrane-associated proteins, specialized strains like C41(DE3) and C43(DE3), derived from BL21(DE3), may provide better expression of correctly folded protein by reducing expression rates and toxicity .

  • Disulfide bond formation: If YghE contains disulfide bonds, consider Origami strains or co-expression with sulfhydryl oxidase and isomerase in reducing cytoplasm .

  • Codon usage: For proteins with rare codons, BL21(DE3)-CodonPlus or Rosetta strains provide additional tRNAs for rare codons.

What are the NIH guidelines for working with recombinant E. coli expressing YghE?

Research involving recombinant E. coli expressing YghE generally falls under NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. The most relevant considerations include:

  • Containment level: Work with most laboratory strains of E. coli (K-12 derivatives) expressing non-toxic, non-virulence proteins typically requires Biosafety Level 1 (BSL-1) containment .

  • Exemptions: Experiments using E. coli K-12 host-vector systems are often exempt from the NIH Guidelines, provided that the host does not contain conjugation-proficient plasmids or generalized transducing phages .

  • IBC approval requirements: The following situations would require Institutional Biosafety Committee (IBC) approval prior to initiation:

    • Large-scale experiments (culture volumes exceeding 10 liters)

    • Cloning DNA from Risk Group 3 or 4 organisms

    • Experiments involving toxic molecules

  • Reporting requirements: Significant problems, violations, or research-related accidents must be reported to the IBC immediately .

Always consult your institutional Biosafety Committee for specific requirements applicable to your research institution.

What are the optimal expression conditions for producing functional recombinant YghE protein?

Optimizing expression conditions for functional recombinant YghE requires careful consideration of multiple parameters:

Expression Vector Selection:

  • pET vectors with T7 promoters are commonly used for high-level expression

  • Consider using vectors with tunable promoters to control expression levels, as excessive production can lead to toxicity and aggregation

Induction Parameters:

  • IPTG concentration: For membrane proteins like YghE, lower IPTG concentrations (0.01-0.1 mM) often yield better results than standard concentrations (1 mM)

  • Induction temperature: Lower temperatures (16-25°C) typically improve proper folding

  • Induction timing: Induce at mid-log phase (OD600 ~0.6-0.8) for optimal balance between cell density and metabolic capacity

Media and Growth Conditions:

  • Rich media (LB) for initial tests

  • Auto-induction media for controlled expression without manual induction

  • Defined minimal media when isotopic labeling is required for structural studies

  • Supplementation with specific metal ions or cofactors if required for proper folding

Co-expression Strategies:

  • Consider co-expression with chaperones (GroEL/GroES, DnaK/DnaJ) to assist in proper folding

  • For membrane proteins, co-expression with components of the membrane insertion machinery may improve yields

Cell Lysis and Extraction:

  • For membrane-associated proteins like YghE, gentle extraction using mild detergents (DDM, LDAO) is preferable to harsh mechanical disruption

  • Extraction buffer composition should be optimized to maintain protein stability

How can I determine if recombinant YghE is properly folded and functional?

Assessing proper folding and functionality of recombinant YghE requires multiple complementary approaches:

Structural Integrity Assessment:

  • SDS-PAGE analysis: Properly folded membrane proteins often show anomalous migration patterns compared to denatured samples

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure elements

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can indicate tertiary structure integrity

  • Limited proteolysis: Properly folded proteins show resistance to proteolytic digestion compared to unfolded ones

Functional Assays:

  • Protein-protein interaction studies: Co-immunoprecipitation with other T2SS components

  • Complementation of yghE knockout strains: Restoration of secretion phenotypes

  • ATPase activity assays: If YghE possesses ATPase activity typical of some T2SS components

Localization Studies:

  • Membrane fractionation: Properly folded YghE should localize to the correct membrane fraction

  • Immunofluorescence microscopy: Visualization of YghE localization in intact cells

  • Protease accessibility: Surface exposure analysis through limited proteolysis of intact cells

A combination of these approaches provides comprehensive evidence for proper folding and functionality.

What are the best methods for purifying recombinant YghE while maintaining its structural integrity?

Purification of membrane-associated proteins like YghE requires specialized approaches to maintain structural integrity:

Solubilization Strategy:

  • Screen multiple detergents (DDM, LDAO, C12E8, etc.) at various concentrations

  • Consider nanodiscs, amphipols, or styrene-maleic acid copolymers (SMALPs) as alternatives to detergents

  • Maintain physiological pH (typically 7.0-8.0) during solubilization

Affinity Purification:

  • His-tags are commonly used for initial capture (IMAC)

  • Consider dual tagging (His-tag plus MBP or GST) for improved solubility and purity

  • Include detergent at concentrations above critical micelle concentration (CMC) in all buffers

Further Purification Steps:

  • Size exclusion chromatography to separate aggregates, monomers, and oligomers

  • Ion exchange chromatography if isoelectric point is favorable

  • Avoid harsh conditions that might disrupt protein structure

Quality Control:

  • Dynamic light scattering to assess homogeneity

  • Negative-stain electron microscopy to visualize protein particles

  • Thermal stability assays (differential scanning fluorimetry) to optimize buffer conditions

Recommended Purification Protocol:

  • Membrane isolation via ultracentrifugation

  • Detergent solubilization (screen multiple conditions)

  • IMAC purification with detergent-containing buffers

  • Tag removal if needed (TEV protease cleavage)

  • Size exclusion chromatography for final polishing

  • Concentration with careful monitoring to avoid aggregation

How does YghE interact with other components of the Type II secretion system in E. coli?

YghE, as an L-type protein in the T2SS, likely plays a crucial role in the assembly and function of the secretion apparatus through specific interactions with other components. Based on studies of homologous systems, we can infer the following interaction patterns:

Key Interacting Partners:

  • Inner membrane platform proteins (GspE, GspF, GspL, GspM)

  • Pseudopilins (GspG, GspH, GspI, GspJ, GspK)

  • Potentially the secretin (GspD) that forms the outer membrane channel

Interaction Characterization Methods:

  • Bacterial two-hybrid assays: Identify binary protein-protein interactions

  • Co-immunoprecipitation: Pull down interacting partners from cell lysates

  • Cross-linking studies: Capture transient interactions within the intact machinery

  • Surface plasmon resonance: Measure binding kinetics between purified components

Structural Studies:

  • Cryo-electron microscopy of purified complexes

  • X-ray crystallography of individual domains or subcomplexes

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

Research on homologous T2SS components suggests that L-type proteins generally form a bridge between the inner membrane platform (particularly the ATPase) and the pseudopilus assembly, helping to couple energy from ATP hydrolysis to pseudopilus extension and substrate secretion.

What is the relationship between YghE and SslE (YghJ) in E. coli Type II secretion?

The relationship between YghE and SslE (formerly YghJ) represents an interesting aspect of the T2SS in E. coli:

Genetic Organization:

  • YghE and SslE (YghJ) are encoded within the same gene cluster in ETEC and EPEC strains, suggesting a functional relationship

  • The ygh operon typically contains genes encoding structural components of the T2SS as well as secreted substrates

Functional Relationship:

  • SslE is a major substrate of the T2SS in EPEC and has been shown to be essential for biofilm formation

  • YghE, as a structural component of the T2SS machinery, would be involved in the secretion of SslE

  • Mutations in the T2SS machinery (including components like YghE) prevent the secretion of SslE and lead to defects in biofilm formation

Research Approaches to Study This Relationship:

  • Co-expression studies: Expression levels and solubility may be interdependent

  • Secretion assays: Quantifying SslE secretion in wild-type vs. YghE mutant strains

  • Localization studies: Determining whether YghE is required for proper localization of SslE

  • Structural studies: Investigating potential direct interactions between YghE and SslE

Understanding this relationship has significant implications for E. coli pathogenesis, as SslE has been identified as a dominant effector of biofilm development and is required for virulence in rabbit models of EPEC infection .

How does the metabolic burden of YghE expression affect E. coli physiology and what strategies can minimize these effects?

Expression of recombinant membrane proteins like YghE can impose significant metabolic burden on E. coli, affecting various aspects of cellular physiology:

Physiological Effects:

  • Growth inhibition: Reduced growth rates and final cell densities

  • Stress responses: Activation of heat shock, envelope stress, and unfolded protein responses

  • Resource diversion: Competition for ribosomes, membrane insertion machinery, and energy

  • Membrane integrity: Potential disruption of membrane composition and function

  • Plasmid instability: Selection pressure for mutations reducing expression

Quantifiable Parameters:

  • Growth rate reduction (measured by OD600 monitoring)

  • Metabolic activity changes (oxygen consumption, ATP levels)

  • Stress response activation (reporter gene assays)

  • Plasmid loss rates during continuous culture

Strategies to Minimize Metabolic Burden:

StrategyImplementationMechanismEffectiveness
Tunable expressionLow inducer concentration (0.01-0.1 mM IPTG)Reduces transcription rateHigh for toxic proteins
Low-copy plasmidspACYC, pBR322 derivativesReduces gene dosageModerate, may reduce yield
Controlled temperatureInduction at 16-25°CSlows expression, improves foldingVery effective for membrane proteins
Specialized strainsC41(DE3), C43(DE3)Mutations reducing T7 RNAP activityHighly effective for toxic proteins
Co-expression of chaperonesGroEL/ES, DnaK/JAssists protein foldingVariable depending on protein
Alternate carbon sourcesGlycerol instead of glucoseChanges metabolic fluxModerate effectiveness
Auto-induction mediaNo manual IPTG additionGradual induction as cells growGood balance of yield vs. toxicity

Research indicates that T7 expression systems using high IPTG concentrations (>0.1 mM) can cause significant stress, potentially leading to selection of host mutations that reduce T7 RNA polymerase activity . Recent studies suggest that understanding the relationship between expression rate, aggregate formation, and toxicity is crucial for optimizing membrane protein production .

What experimental approaches can resolve contradictory data regarding YghE function in different E. coli strains?

When faced with contradictory data regarding YghE function across different E. coli strains, systematic experimental approaches can help resolve discrepancies:

Sources of Variability:

  • Strain-specific differences: Genetic backgrounds may affect YghE function

  • Expression conditions: Different growth and induction protocols

  • Assay sensitivity: Varying detection methods and thresholds

  • Experimental design: Different control groups or statistical approaches

  • Genetic context: Presence of compensatory mechanisms in some strains

Systematic Resolution Approach:

  • Standardized Strain Panel Testing:

    • Use a diverse panel of well-characterized E. coli strains (pathogenic and non-pathogenic)

    • Create isogenic knockout mutants using the same methodology

    • Express YghE from the same vector under identical conditions

    • Compare phenotypes using standardized assays

  • Multi-laboratory Validation:

    • Implement round-robin testing with identical protocols and materials

    • Share strains, plasmids, and reagents between laboratories

    • Perform blinded analyses to reduce experimental bias

  • Complementation Studies:

    • Express YghE variants from different strains in a single knockout background

    • Determine if strain-specific YghE sequences account for functional differences

    • Create chimeric YghE proteins to map functional domains

  • Systems Biology Approaches:

    • Transcriptomics to identify strain-specific gene expression patterns affecting YghE function

    • Proteomics to characterize strain-specific interaction partners

    • Metabolomics to identify downstream metabolic effects of YghE activity

  • In Vivo Model Validation:

    • Test YghE function from different strains in relevant animal models

    • Correlate in vitro observations with in vivo phenotypes

    • Use tissue-specific or condition-specific expression systems

When analyzing experimental results, statistical approaches should include:

  • Multiple biological and technical replicates

  • Appropriate statistical tests based on data distribution

  • Effect size reporting rather than just p-values

  • Meta-analysis of combined datasets when possible

What biosafety precautions should be taken when working with recombinant E. coli expressing YghE?

Working with recombinant E. coli expressing YghE requires appropriate biosafety measures based on the strain characteristics and research goals:

Standard Biosafety Measures:

  • Containment level: Most laboratory work with non-pathogenic E. coli strains (K-12 derivatives) expressing YghE can be conducted at Biosafety Level 1 (BSL-1)

  • Personal protective equipment: Lab coat, gloves, and eye protection

  • Engineering controls: Work in areas with appropriate containment (e.g., biosafety cabinets when aerosols might be generated)

  • Waste management: Proper decontamination of all materials containing recombinant organisms

Special Considerations:

  • If using pathogenic E. coli strains (ETEC, EPEC, UPEC), higher containment levels (BSL-2) may be required

  • Expression of YghE in strains capable of colonizing human intestines requires additional containment considerations

  • Large-scale cultures (>10 liters) require IBC approval according to NIH guidelines

Risk Assessment Factors:

  • Origin of the yghE gene (pathogenic vs. non-pathogenic strain)

  • Host strain characteristics (laboratory-adapted vs. clinical isolate)

  • Scale of the experiment

  • Procedures that might generate aerosols (sonication, centrifugation)

Documentation Requirements:

  • Maintain records of risk assessment

  • Document any modifications to standard protocols

  • Record any accidents or near-misses

  • Keep training records for all personnel

Always consult your institutional Biosafety Committee for specific requirements at your research institution.

How should unexpected results or potential hazards in YghE research be documented and reported?

Proper documentation and reporting of unexpected results or potential hazards is crucial for scientific integrity and safety:

Documentation Protocol:

  • Laboratory notebook records: Maintain detailed, chronological documentation of all experiments, including unexpected results

  • Photographic evidence: Capture images of unusual colonies, growth patterns, or experimental outcomes

  • Raw data preservation: Store all original data files securely with appropriate metadata

  • Experimental conditions: Document all conditions including media, temperature, strain information, and protocols used

Internal Reporting Procedure:

  • Immediate supervisor notification: Report unexpected results to your supervisor

  • Research team meeting: Discuss findings with the research team

  • Repeat experiments: Verify reproducibility with appropriate controls

  • Root cause analysis: Systematically investigate possible causes

Formal Reporting Requirements:

  • Institutional Biosafety Committee (IBC): Report significant problems, violations, or research-related accidents immediately using an Adverse Biosafety Event Report Form

  • Animal Facility Director: Where applicable, report issues that might affect animal studies

  • NIH Office of Science Policy: For serious biosafety breaches or incidents involving recombinant DNA

  • Funding agencies: Report according to grant requirements

Publication Considerations:

  • Transparent reporting: Include unexpected results in publications with appropriate discussion

  • Method sharing: Provide detailed methods to allow other researchers to verify findings

  • Pre-registration: Consider pre-registering study designs for improved transparency

Timely and accurate reporting not only fulfills regulatory requirements but also contributes to the advancement of scientific knowledge and safety practices in the field.

What emerging technologies might enhance our understanding of YghE function in the Type II secretion system?

Several cutting-edge technologies show promise for advancing our understanding of YghE and other T2SS components:

Structural Biology Advances:

  • Cryo-electron microscopy (Cryo-EM): Near-atomic resolution structures of intact T2SS machinery in different functional states

  • Integrative structural biology: Combining X-ray crystallography, NMR, and cryo-EM data for complete structural models

  • In situ structural studies: Cellular tomography to visualize T2SS assemblies in their native environment

Protein Engineering Approaches:

  • Split fluorescent protein systems: Visualizing YghE interactions with other T2SS components in live cells

  • Optogenetic control: Light-controlled activation or inhibition of YghE function

  • De novo designed T2SS components: Engineering simplified systems to understand essential functional elements

Genomics and Systems Biology:

  • CRISPR-Cas9 screening: Genome-wide identification of factors affecting YghE function

  • Single-cell transcriptomics: Understanding cellular heterogeneity in T2SS expression

  • Proteome-wide interaction mapping: Comprehensive identification of YghE interaction networks

Computational Approaches:

  • Molecular dynamics simulations: Modeling YghE conformational changes during secretion cycles

  • Machine learning: Predicting functional interactions based on sequence and structural data

  • Protein structure prediction: Using AlphaFold2 and RoseTTAFold to model previously uncharacterized T2SS components

Biophysical Techniques:

  • Single-molecule FRET: Measuring conformational changes in real-time

  • High-speed atomic force microscopy: Visualizing T2SS dynamics at the nanoscale

  • Native mass spectrometry: Determining stoichiometry and assembly of T2SS subcomplexes

These technologies, particularly when combined in complementary approaches, promise to reveal the dynamic assembly, substrate recognition mechanisms, and energy coupling in the T2SS machinery.

How might artificial intelligence tools help clarify the contradictory experimental results in recombinant protein production studies?

Artificial intelligence (AI) approaches offer powerful tools to address the complexities and contradictions in recombinant protein production research:

Data Integration and Meta-analysis:

  • Literature mining: Automated extraction of experimental conditions and results from published studies

  • Cross-study normalization: Standardizing data from different laboratories and experimental designs

  • Pattern recognition: Identifying hidden variables that influence experimental outcomes

Predictive Modeling:

  • Expression optimization: Predicting optimal conditions for specific protein-strain combinations

  • Solubility prediction: Estimating likelihood of proper folding based on sequence features

  • Strain selection: Recommending host strains for specific recombinant proteins

Experimental Design Optimization:

  • Bayesian optimization: Efficient exploration of complex parameter spaces

  • Active learning: Selecting the most informative experiments to resolve contradictions

  • Adaptive experimental design: Modifying protocols based on real-time data

  • More systematic experimental approaches

  • Collection of sufficiently uniform data

  • Standardized reporting of experimental conditions

  • Sharing of negative results and failed experiments

A particularly promising application is the development of integrated models that simultaneously account for:

  • Transcription and translation rates

  • Protein folding kinetics

  • Host metabolic state

  • Growth conditions

  • Genetic background

Such integrated approaches could help resolve the fundamental question of what truly constitutes the "metabolic burden" in recombinant protein expression systems.

What potential biotechnological applications might emerge from a deeper understanding of YghE and the Type II secretion system?

Enhanced understanding of YghE and the T2SS could enable numerous biotechnological applications:

Protein Secretion Platforms:

  • Engineered secretion hosts: E. coli strains with optimized T2SS for efficient protein secretion

  • Simplified T2SS variants: Minimal secretion systems with reduced complexity

  • Hybrid secretion systems: Combining elements from different bacterial secretion pathways for novel functions

Therapeutic Applications:

  • Vaccine development: Secretion of antigens directly by live bacterial vectors

  • Antimicrobial strategies: Targeting T2SS to inhibit pathogen virulence

  • Protein delivery systems: Using modified T2SS to deliver therapeutic proteins to specific sites

Industrial Biotechnology:

  • Enzyme secretion: Enhanced production of industrial enzymes without cell disruption

  • Continuous bioprocessing: Coupling growth and secretion for streamlined manufacturing

  • Whole-cell biocatalysts: Surface display of enzymes via modified T2SS components

Biosensing and Environmental Applications:

  • Engineered biofilms: Controlled biofilm formation for bioremediation

  • Bacterial sensors: Detection of environmental contaminants through engineered T2SS-dependent reporters

  • Bioleaching: Enhanced metal extraction through secreted enzymes

Potential Impact on Biomanufacturing:

ApplicationCurrent LimitationsT2SS-Based SolutionsPotential Benefits
Therapeutic protein productionIntracellular accumulation requiring cell lysisSecretion to culture mediumSimplified downstream processing, reduced endotoxin contamination
Industrial enzyme productionInclusion body formation, complex refoldingDirected secretion of folded enzymesHigher active enzyme yields, continuous production
Vaccine manufacturingComplex purification from cellular materialDirect antigen secretionReduced process steps, potentially enhanced immunogenicity
Biosensor developmentLimited sensitivity, complex fabricationLiving sensors with amplified signal outputEnhanced detection limits, regenerative sensing systems

The development of these applications would require overcoming current challenges in T2SS engineering, including substrate specificity, secretion efficiency, and system stability in different industrial conditions.

What strategies can address low expression yields of recombinant YghE protein?

Low expression yields of membrane proteins like YghE are a common challenge. Here are systematic troubleshooting strategies:

Expression Vector Optimization:

  • Promoter strength: Test different promoters (T7, tac, araBAD) for optimal expression level

  • Codon optimization: Optimize codons for E. coli usage, particularly for rare codons

  • 5' UTR engineering: Optimize translation initiation region for improved ribosome binding

  • Vector copy number: Try both high and low copy number vectors

Expression Conditions:

  • Induction parameters: Screen different inducer concentrations and induction times

  • Growth temperature: Test lower temperatures (16°C, 20°C, 25°C) to improve folding

  • Media composition: Compare rich media (LB, TB) versus defined media

  • Growth phase: Test induction at different cell densities (early, mid, late log phase)

Host Strain Selection:

  • Specialized strains: C41(DE3), C43(DE3) for toxic membrane proteins

  • Chaperone co-expression: Strains with additional chaperones or foldases

  • Protease-deficient strains: BL21 derivatives lacking lon and ompT proteases

  • Rare codon strains: Rosetta or CodonPlus strains providing additional tRNAs

Fusion Strategies:

  • Solubility-enhancing tags: MBP, SUMO, TrxA fusions at N-terminus

  • Secretion signals: PelB, OmpA leaders for periplasmic targeting

  • Fluorescent protein fusions: GFP fusions to monitor folding and expression

Systematic Screening Approach:

  • Start with small-scale expression tests (5-10 ml cultures)

  • Use a factorial design to test combinations of key variables

  • Analyze results by Western blotting and activity assays

  • Scale up the most promising conditions

For YghE specifically, reports on homologous T2SS components suggest that expression at lower temperatures (20°C) with moderate inducer concentrations (0.1 mM IPTG) in C43(DE3) hosts may provide a good starting point for optimization.

How can I troubleshoot problems with YghE incorporation into the bacterial membrane?

Proper membrane incorporation is crucial for YghE function. Here's a systematic approach to troubleshooting membrane integration issues:

Diagnostic Methods:

  • Membrane fractionation: Separate inner and outer membranes to locate YghE

  • Protease accessibility: Determine surface exposure in spheroplasts

  • Fluorescence microscopy: Visualize localization using fluorescent protein fusions

  • Membrane extraction: Test extractability with different detergents

Common Problems and Solutions:

ProblemPotential CausesDiagnostic SignsSolutions
Aggregation in cytoplasmOverwhelming membrane insertion machineryInclusion bodies visible by microscopyReduce expression rate, lower temperature, co-express chaperones
Incorrect membrane targetingMissing or ineffective signal sequencesProtein found in cytoplasmic fractionVerify signal sequence, try different targeting sequences
DegradationMisfolded protein triggering proteolysisMultiple bands or no band on Western blotUse protease-deficient strains, optimize folding conditions
Toxicity to host cellsDisruption of membrane integrityGrowth arrest upon inductionUse leak-proof expression systems, specialized host strains

Optimization Strategies:

  • Co-expression partners: Express with other T2SS components to facilitate assembly

  • Membrane composition modification: Supplement with specific phospholipids

  • Controlled expression: Use titratable promoters to match expression rate to membrane insertion capacity

  • Fusion approaches: N-terminal fusions to well-expressed membrane proteins

Advanced Approaches:

  • In vitro membrane reconstitution: Express, purify, and reconstitute into liposomes

  • Cell-free expression systems: Coupled transcription-translation with supplied membranes

  • Domain swapping: Create chimeric proteins with well-expressed membrane proteins

When troubleshooting membrane incorporation, it's important to consider the natural assembly pathway of YghE in the context of the T2SS machinery, as proper folding may depend on interactions with other components of the secretion system.

How can structural biology approaches complement functional studies of YghE?

Integrating structural biology with functional studies provides a comprehensive understanding of YghE:

Complementary Structural Approaches:

  • X-ray crystallography: High-resolution structures of individual domains or complexes

  • Cryo-electron microscopy: Structures of larger assemblies and conformational states

  • NMR spectroscopy: Dynamic information and solution-state interactions

  • SAXS/SANS: Low-resolution envelopes of flexible complexes

  • Cross-linking mass spectrometry: Identifying interaction interfaces

Structure-Function Integration:

  • Site-directed mutagenesis guided by structures: Testing functional roles of specific residues

  • Domain deletion studies: Determining minimal functional units

  • Structure-based computational predictions: Identifying potential functional sites

Specific Questions Addressable by Structural Biology:

  • How does YghE interact with other T2SS components?

  • What conformational changes occur during the secretion cycle?

  • How is ATP hydrolysis coupled to mechanical work through YghE?

  • What structural features determine substrate specificity?

Technical Challenges and Solutions:

  • Membrane protein crystallization difficulties → Detergent screening, LCP crystallization

  • Conformational heterogeneity → Stabilizing antibodies or nanobodies

  • Complex assembly → Co-expression and co-purification strategies

The structural information obtained can directly inform functional studies by:

  • Identifying key residues for mutagenesis

  • Revealing potential binding pockets for inhibitor design

  • Guiding the design of protein engineering experiments

  • Providing a framework for interpreting phenotypic data from various mutants

What can evolutionary analysis tell us about YghE conservation and specialization across bacterial species?

Evolutionary analysis provides valuable insights into YghE function and specialization:

Conservation Patterns:

  • Sequence conservation: Identifying highly conserved residues likely critical for function

  • Domain architecture: Mapping conserved versus variable domains across species

  • Co-evolution: Detecting coordinated evolution with other T2SS components

Phylogenetic Approaches:

  • Phylogenetic tree construction: Tracing the evolutionary history of YghE

  • Ancestral sequence reconstruction: Inferring properties of ancestral YghE proteins

  • Horizontal gene transfer analysis: Identifying potential acquisition events

Functional Divergence:

  • Positive selection analysis: Detecting adaptively evolving sites

  • Specialization shifts: Identifying lineage-specific functional adaptations

  • Gene duplication events: Understanding paralog diversification

Comparative Genomics:

  • Genomic context analysis: Examining conservation of gene neighborhoods

  • Presence/absence patterns: Correlating with ecological niches and pathogenicity

  • Synteny analysis: Detecting genomic rearrangements affecting T2SS clusters

T2SS components show interesting evolutionary patterns across bacterial species. For example, in E. coli, examination of the K-12 genome suggests it once possessed a functional T2SS that has been lost or become non-functional . Conversely, pathogenic E. coli strains have maintained functional T2SS clusters, highlighting their importance in virulence .

Evolutionary analyses can also reveal species-specific adaptations of the T2SS machinery to different secreted substrates and environmental conditions, providing insights into bacterial adaptation and pathogenesis mechanisms.

How does our understanding of YghE contribute to the broader field of bacterial secretion systems?

YghE research contributes to the broader understanding of bacterial secretion systems in several ways:

Comparative System Analysis:

  • Architectural principles: Common design elements across secretion systems

  • Energy coupling mechanisms: How ATP hydrolysis drives secretion processes

  • Assembly pathways: General principles of multiprotein complex formation

  • Membrane traversal: Common solutions to the membrane barrier problem

Evolutionary Relationships:

  • T2SS and T4P relationship: Understanding the evolutionary connection between secretion systems and pili

  • System specialization: How secretion systems adapt to specific substrate classes

  • Host-pathogen co-evolution: Adaptations in secretion systems in response to host defenses

Biotechnological Applications:

  • Secretion system engineering: Lessons from T2SS applicable to other systems

  • Heterologous protein secretion: Common challenges and solutions

  • Antimicrobial development: Conserved targets across secretion systems

Research Methodology Advances:

  • Membrane protein biochemistry: Technical advances applicable to other systems

  • Structural biology approaches: Methods for large membrane complexes

  • Functional assays: Standardized approaches for measuring secretion efficiency

The study of YghE and the T2SS contributes to our fundamental understanding of how bacteria interact with their environment, whether in pathogenic relationships, symbiotic associations, or environmental adaptations. This knowledge informs not only our understanding of bacterial physiology but also potential interventions in medical and biotechnological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.